KEGG   Pseudomonas aeruginosa PA7: PSPA7_5063Help
Entry
PSPA7_5063        CDS       T00569                                 

Definition
lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
Enzymes [BR:pap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PSPA7_5063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5208521..5208982
Genome map
AA seq 153 aa AA seqDB search
MKLPPKLAAGGGVLALAAALVAPFEGRSLVAYLDPVGIPTICEGITAGVRMGDRATPAEC
DALLERELQRAVDAVDRQVLVPLPDTRRAALGSFVYNVGEGQLARSTLLRKLNAGDVRGA
CAELSRWVYAGGKKLGGLVRRRAAERELCEIGL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgccgcccaagctggccgccggcggcggcgtgctggcactggccgccgccctg
gttgcgccgttcgaggggcgttcgttggtggcctacctggacccagtgggaatcccgacg
atctgcgagggcatcaccgccggcgtgcgcatgggcgacagggcgaccccggccgagtgc
gatgcactgcttgaacgcgagctgcagcgcgccgtcgatgccgtggaccgccaggtcctg
gtgccgctgcccgacacccgccgcgccgccctgggctcgttcgtctacaacgtcggcgaa
ggccagttggcccgctcgacgctgctgcgcaagctcaacgccggcgacgtgcgcggcgcc
tgcgccgagctgtcgcgctgggtctacgccggcgggaagaagctcggcggcctggttcgc
cggcgcgcagcagagcgcgaactgtgcgagatcggtctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system