KEGG   Pseudomonas aeruginosa PA7: PSPA7_5227Help
Entry
PSPA7_5227        CDS       T00569                                 

Gene name
ccpR
Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PSPA7_5227 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5374294..5375334
Genome map
AA seq 346 aa AA seqDB search
MQSSSLLPLGSLLLSFAMPLAHADPLHDQASALFKPIPEQVTELRGQAINEQQRELGKKL
FFDPRLSRSHVLSCNTCHNVGTGGADNVPTSVGHGWQKGPRNSPTVFNAVFNAAQFWDGR
AKDLGEQAKGPVQNSVEMHSTPQLVEQTLGSIPEYVDAFRKAFPKAGKPVSFDNMALAIE
AYEATLVTPDSPFDLYLKGDDNALDARQKKGLKAFMDSGCSACHNGINLGGQAYFPFGLV
KKPDASVLPSGDKGRFAVTKTQSDEYVFRAAPLRNVALTAPYFHSGQVWELKDAVAIMGN
AQLGKQLAPDDVENIVAFLHSLSGKQPRVEYPLLPASTETTPRPAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctcgtcactgctcccgcttggcagcctgttgctgtcgttcgccatgcccctc
gcccatgccgaccccctgcacgaccaggccagcgccctgttcaagccgattcccgagcag
gtcaccgaactgcgcggccaggccatcaacgaacagcagcgcgaactcggcaagaagctg
ttcttcgacccgcgcctgtcgcgcagccatgtgctcagctgcaacacctgccacaacgtc
ggcaccggcggcgccgacaacgtgccgacctcggtcggccacggctggcagaaaggcccg
cgcaactcaccgacggtgttcaacgcggtattcaacgccgcgcagttctgggacggccgc
gccaaggacctgggagaacaggccaagggccctgtccagaacagcgtggagatgcacagc
accccgcaactggtggaacagaccctgggcagcatcccggaatacgtcgacgccttccgc
aaggccttccccaaggccggcaagccggtcagcttcgacaacatggcgctggccatcgaa
gcctacgaggcgaccctggtaacccccgactcgcccttcgacctgtacctcaagggcgac
gacaacgccctcgacgcgcggcagaagaaaggtctcaaggcgttcatggacagtggctgc
agcgcctgccacaacggcatcaacctgggcggccaggcctacttcccgttcggcctggtg
aagaagcccgacgccagcgtcctgcccagcggcgacaagggccgcttcgcggtgaccaag
acccagagcgacgagtacgtgttccgcgccgcgcccctgcgcaacgtcgcactcaccgcg
ccgtacttccacagcggccaggtctgggagctcaaggacgccgtggcgatcatgggcaac
gcccagctcggcaagcaactggcgccggatgacgtggagaacatcgtggccttcctgcac
agcctgagcggcaagcaaccacgggtggaatacccgctgctgccggccagcaccgagacc
acgccacgcccggcggaatga

DBGET integrated database retrieval system