KEGG   Pseudomonas aeruginosa PA7: PSPA7_5276Help
Entry
PSPA7_5276        CDS       T00569                                 

Definition
3-beta hydroxysteroid dehydrogenase/isomerase family protein
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     PSPA7_5276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5438784..5439773)
Genome map
AA seq 329 aa AA seqDB search
MKYAVLGATGLLGHHAARAIRAAGHDLVLVHRPSSQIQRLAYLEPECRVAEMLDHAGLER
ALRGLDGVIFSAGYYPSRPRRWQEEVASALGQTNPFYAACLQARVPRILYVGSAYAMPRH
PQGLPGHEGLFYDSLPSGKSSYVLCKWALDEQAREQARNGLPVVIGIPGMVLGELDIGPT
TGRVITAIGNGEMTHYVAGQRNVIDAAEAGRGLLMALERGRIGERYLLTGHNLEMADLTR
RIAELLGQPAPQPMSMAMARALATLGRLRYRVSGQLPLLDETAIEVMAGGQFLDGRKARE
ELGFFSTTALDDTLLRAIDWFRDNGYFNT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacgccgtactcggagccaccggcctgctgggacatcacgccgcgcgcgctatc
agggccgccggtcacgatctggtgctggtccaccgtccttcttcacagatccagcgtctc
gcctatctggagcccgagtgccgggtcgccgagatgctcgatcacgccggcctggagcgc
gcgctgcgcggcctcgacggagtgatcttcagcgccggctactatccgtcgcggccacgc
cgctggcaggaggaagtggccagcgcgctgggccagaccaatccgttctacgccgcctgc
ctgcaggcgcgggtgccgcgcatcctctatgtcggctcggcctacgccatgccgcgccat
ccgcagggcctgccgggacacgaggggctgttctacgacagcctgccgagtggcaagagt
tcctacgtgctgtgcaagtgggcgctcgacgagcaggcccgggagcaggcgcgcaatggc
ctgccggtggtgatcgggattcccggaatggtcctcggcgaactggacatcggcccgacc
accgggcgcgtgatcaccgccatcggcaatggcgagatgacccactacgtcgccggccag
cgcaacgtcatcgacgccgccgaagccggccgcggcctgctgatggccctggagcgcggg
cgcatcggcgagcgctacctgctgaccgggcacaacctggagatggccgacctgacccgg
cgcatcgccgaactgctcggccagccggcaccgcagccgatgtcgatggccatggctcgc
gccctggccaccctcggccgcctgcgctaccgggtcagcggccagttgccgctgctcgac
gagaccgctatcgaggtgatggccggagggcagttcctcgatggacgcaaggcccgcgag
gaactcggcttcttctccaccaccgccctggacgacaccctgctgcgcgccatcgactgg
ttccgcgacaacggctatttcaacacctag

DBGET integrated database retrieval system