KEGG   Pseudomonas aeruginosa PA7: PSPA7_5450Help
Entry
PSPA7_5450        CDS       T00569                                 

Gene name
acsA1
Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pap01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pap00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pap00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pap00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pap00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5617587..5619524
Genome map
AA seq 645 aa AA seqDB search
MFEISVHPVPEAVRQRAYLNDDDYRRLYRQSVENPEEFWGEQAKAFLDWFKPWHSVHHGD
LRKGQASWFKGGQLNVAYNCIDRHLERRGEQIAIVWEGDNPSESAHITYRKLHHNVCRLA
NVLKSRGVEKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCR
TVITADEGVRGGKYIPLKQNVEKALEDCPEVSTVVVVERTQGDIPWVEGRDLWYHEALHA
ASADCPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHDGDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRA
LMREGDGPVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPIVDTWWQTETGSILI
TPLPGATALKPGSATRPFFGVQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQR
MIDTYFKPYPGYYFSGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGCPHEVKGQAIYAFVTLMAGSQPDEALQQELLALVGKEIGSFAKPDHLQWAPSLP
KTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcagcgtccacccggtgccggaggccgtccgccagcgtgcctacctgaac
gatgacgactaccggcgcctgtaccgccagtccgtggaaaatcccgaggaattctggggc
gagcaggccaaggccttcctcgactggttcaagccctggcacagcgtccaccatggcgat
ctgagaaagggccaggccagctggttcaagggcggccagctgaacgtcgcctacaactgc
atcgaccgccatctggagcgccgcggcgagcagatcgccatcgtctgggaaggcgacaat
cccagcgaatccgcgcatatcacctaccgcaagctgcaccacaacgtctgccgcctggcc
aacgtgctgaagagccgcggggtggagaagggcgaccgggtctgcatctacatgccgatg
attcccgaggccgcctacgccatgctcgcctgcgcccgcatcggcgcggtgcactcggtg
gtgttcggcggcttttcgccggactcgctgcgcgaccgcatcctcgatgccgactgccgc
accgtgatcaccgccgacgagggcgtgcgcggcggcaagtacattccgctgaaacagaat
gtggaaaaggcgctggaggattgcccggaggtctccaccgtggtggtggtcgagcgcacc
cagggcgacatcccctgggtcgaaggtcgtgacctctggtaccacgaggcactccacgcg
gcttccgccgactgcccggcggaagcgatggacgccgaggacccgctgttcatcctctat
acctccggcagcaccggcaagccgaagggcgtgttgcacaccaccggtggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgacggcgatgtctactggtgc
accgccgacgtcggctgggtcaccgggcacagctacatcgtctacggcccgctggccaac
ggcgccaccaccctgatgttcgagggcgtgcccaactacccggacgcctcgcgcttctgg
caagtgatcgacaagcaccaggtgaacatcttctacaccgcgccgaccgcgatccgcgcc
ctgatgcgcgaaggcgacgggccggtgcgccagacctcgcgcagcagcctgcgcctgctc
ggctcggtgggcgaaccgatcaatccggaggcctgggagtggtactaccaggtggtcggc
gagaagcgttgcccgatcgtggacacctggtggcagaccgagaccggcagcatcctgatc
accccgctgcccggcgccaccgcgctcaaaccgggctcggccacccggccgttcttcggc
gtgcaaccggtgctgctcgacgagaaaggcaaggaaatcgacggcgcgggcagcggcgtg
ctggcgatcaaggccagttggccgagccagatccgcagcgtctacggcgatcaccagcgg
atgatcgacacctacttcaagccctacccgggctactacttcagcggcgacggcgcgcgg
cgcgacgaggacggctactactggatcaccggccgggtcgacgacgtgatcaacgtctcc
ggccaccgcatcggcaccgccgaggtcgagagcgcgctggtcctgcacgacgcggtggcc
gaagcggcggtggtcggctgcccgcacgaggtgaagggccaggcgatctatgccttcgtc
accctgatggccggcagccagcccgacgaggcgctgcagcaggaactgctggcgctggtc
ggcaaggagatcggcagcttcgccaagccggaccacctgcaatgggcgcccagcctgccg
aagacccgctccggcaagatcatgcggcgtatcctgcgcaagatcgcctgcaacgagctg
gacagtctcggcgatacctcgaccctggccgatccgggagtggtgcaggggttgatcgac
aaccgcctcaaccgctga

DBGET integrated database retrieval system