KEGG   Pseudomonas aeruginosa PA7: PSPA7_5468Help
Entry
PSPA7_5468        CDS       T00569                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPA7_5468 (tpiA)
   01230 Biosynthesis of amino acids
    PSPA7_5468 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_5468 (tpiA)
   00051 Fructose and mannose metabolism
    PSPA7_5468 (tpiA)
   00562 Inositol phosphate metabolism
    PSPA7_5468 (tpiA)
Enzymes [BR:pap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSPA7_5468 (tpiA)
Exosome [BR:pap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSPA7_5468 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSPA7_5468 (tpiA)
  Exosomal proteins of melanoma cells
   PSPA7_5468 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5634801..5635556)
Genome map
AA seq 251 aa AA seqDB search
MRRPLVAGNWKMHGTHSSVADLIKGLRQLALPSGVDVAVMPPCLFISQVVQGLAGKAIGV
GAQNSAVEPMQGALTGEIAPSQLADAGCGMVLVGHSERRLILGESDEVVSRKFAAAQSCG
LVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASP
AQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNAD
EFGAICRAAGS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgacccttggtggccggtaactggaaaatgcacggtacgcattccagtgtggcc
gacttgatcaaaggcttgcgtcagctggcgttgccgagcggagtcgatgtggcggtgatg
ccgccttgcttgttcatcagtcaggtcgttcagggcctggctggcaaggcgatcggcgta
ggtgcgcagaatagcgccgtcgagccgatgcaaggcgcgctgaccggcgagatagctccc
agtcagttggcggatgccggttgcggcatggtcctggtgggacactcggaacgtcgcctg
attctcggcgagagtgacgaggttgtgagtcgcaagtttgccgcggctcagtcgtgtggc
ctggtgccggtgctgtgtgtcggggagacccgggcggagcgcgaggcgggcaagacgctg
gaggttgtcgcgaggcagctgggaagcgtgatcgacgagttgggtgttggagcttttgct
cgcgcagtcgtggcttacgagccggtctgggcgatcgggaccgggttgaccgcgtccccc
gcgcaagcccaggaagtgcacgcggcgatccgcgcgcaactggcagcggaaaatgccgag
gtcgcaaaaggtgtgcgactcctttatggcggaagcgtaaaggcggcaagtgcagccgaa
ttgttcggcatgccggatatcgatggggggctggtaggtggggcctccctgaatgcggat
gagttcggtgcgatctgtcgtgccgcgggaagctga

DBGET integrated database retrieval system