KEGG   Pseudomonas aeruginosa PA7: PSPA7_5752Help
Entry
PSPA7_5752        CDS       T00569                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00010  Glycolysis / Gluconeogenesis
pap00020  Citrate cycle (TCA cycle)
pap00620  Pyruvate metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
Module
pap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_5752 (aceF)
   00020 Citrate cycle (TCA cycle)
    PSPA7_5752 (aceF)
   00620 Pyruvate metabolism
    PSPA7_5752 (aceF)
Enzymes [BR:pap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSPA7_5752 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H HlyD_D23 RnfC_N PYNP_C NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABR86629
UniProt: A6VDD6
Position
5931826..5933469
Genome map
AA seq 547 aa AA seqDB search
MSELIRVPDIGNGEGEVIELLVKPGDKVEADQSLLTLESDKASMEIPSPKAGVVKSIKAK
VGDTLKEGDEILELEVEGGEQPAEAKAEAAPAQPEAPKAEAPAPAPSESKPAAPAAASVQ
DINVPDIGSAGKANVIEVMVKAGDTVEADQSLITLESDKASMEIPSPAPGVVESVTIKVG
DEVGTGDLILKLKVEGAAPAAEEKPAAAPAQAAAPAAEQKPATAAPAPAKADAAAPVGAP
SRDGAKVHAGPAVRMLAREFGVELSEVKASGPKGRILKEDVQVFVKEQLQRAKSGGAGAT
GGAGIPPIPEVDFSKFGEVEEVAMTRLMQVGAANLHRSWLNVPHVTQFDQSDITDMEAFR
VAQKAAAEKAGVKLTVLPILLKACAHLLRELPDFNSSLAPSGKALIRKKYVHIGFAVDTP
DGLLVPVIRDVDRKSLLQLAAEAAELADKARNKKLSADAMQGACFTISSLGHIGGTGFTP
IVNAPEVAILGVSKATMQPVWDGKAFQPRLMLPLSLSYDHRVINGAAAARFTKRLGELLA
DIRTLLL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacccgacatcggcaacggtgagggtgaagtcatcgagctg
ctggtcaagcccggcgacaaggtcgaggccgaccagagcctgctgaccctggaatccgac
aaggccagcatggaaatccccagtcccaaggccggggtagtgaaaagcatcaaggcgaag
gtcggcgacaccttgaaggaaggtgacgagatcctcgagctggaagtggaaggcggcgaa
cagcctgccgaagccaaggccgaggcagcgcccgcccaaccggaagcgccgaaagccgaa
gcacctgctcccgccccgagcgaaagcaagccggccgcccccgccgcggccagcgtccag
gacatcaacgtcccggacatcggctcggccggcaaggccaacgtcatcgaggtgatggtc
aaggccggcgacacggtcgaggccgaccagtcgctgatcaccctggagtccgacaaggcc
agcatggaaatcccctcgccggcccccggtgtggtggaaagcgtgacgatcaaggtcggt
gacgaagtcggtaccggcgacctgatcctcaagctcaaggtcgaaggcgccgctccggca
gccgaagagaagccggcggccgctccggcccaggccgcggcacccgccgccgagcagaag
cccgccacggcggcccccgcgccggccaaggccgatgccgcggccccggtcggcgcgccc
agccgcgacggcgccaaggtgcatgccggcccggccgtgcgcatgctggcccgcgagttc
ggcgtcgagctgagcgaagtgaaggccagcggtccgaaaggccgcatcctcaaggaagac
gtccaggtcttcgtcaaggagcagctgcagcgcgccaagtccggcggcgcgggagccacc
ggcggtgccggcatcccgccgatcccggaagtcgacttcagcaagttcggcgaagtggaa
gaagtggcgatgacccgcctgatgcaggtcggcgccgccaacctgcaccgcagttggctg
aacgtgccgcacgtgacccagttcgaccagtcggacatcaccgacatggaagccttccgc
gtcgcccagaaagccgcggcggagaaggccggggtcaagctgaccgtgctgccgatcctg
ctcaaggcctgtgcccacctgctcagggaactgccggacttcaacagttcgctggccccc
agcggcaaggcgctgatccgcaagaaatacgtgcacatcggcttcgccgtggacaccccg
gacggcctgctggtcccggtgatccgcgacgtcgaccggaagagcctcctgcagttggcc
gccgaggccgccgagctggccgacaaggcccgcaacaagaagctctccgccgatgccatg
cagggcgcctgcttcaccatttccagcctcggccatattggcggcaccggcttcacgccg
atcgtcaacgcgccggaagtggcgatcctcggtgtgtccaaggcgaccatgcagccggtg
tgggacggcaaggccttccagccgcgcctgatgctgccgctgtcgctgtcctacgatcac
cgggtgatcaacggcgccgccgcggcgcgcttcaccaagcgcctgggcgagctgctggcg
gacatccgcaccctgctcctgtaa

DBGET integrated database retrieval system