KEGG   Pseudomonas aeruginosa PA7: PSPA7_6098Help
Entry
PSPA7_6098        CDS       T00569                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_6098 (algC)
   00030 Pentose phosphate pathway
    PSPA7_6098 (algC)
   00051 Fructose and mannose metabolism
    PSPA7_6098 (algC)
   00052 Galactose metabolism
    PSPA7_6098 (algC)
   00500 Starch and sucrose metabolism
    PSPA7_6098 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPA7_6098 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PSPA7_6098 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPA7_6098 (algC)
Enzymes [BR:pap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSPA7_6098 (algC)
    5.4.2.8  phosphomannomutase
     PSPA7_6098 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6305056..6307662
Genome map
AA seq 868 aa AA seqDB search
MKLFQRTAKEGNELGDLLEAEKKPLKAPSERAGGKDLLPGIGASLLGVAAAGALLWFGVF
GGAGEAQQRQLDAAWSEGQAGALRQALQQLAADTRAAAASPLALEALQSGDAARIEAAQR
SLLAWDGVVDAHLNAPGQAVQDNASPAPVSFAALDILHRVESGQSVAAEAYKVGQRWLLY
SAAPVRGADQSLQGTLLLAVDLQRLLRALPPLPDDAGQVQLVQQFSGAPAQVLLQRGTAA
PDQGAQALDSGNPNWKLNYTPGSTAASQASPLLLGLAALLALLGGVLGAYLTRSSLLRRL
HQDVLTLGQYLQELGGQRTAKPPVPSLPGFAPLIQALARQPRRKPEPASAPSPAKAAPVA
PVAVTKAPPREEPALADPLFQNTDILDIDILDEDQDLLGLEQTPIMSTAKAPTLPASIFR
AYDIRGVVGDTLTAETAYWIGRAIGSESLARGEPCVAVGRDGRLSGPELVERLIQGLVDC
GCQVSDVGMVPTPVLYYAANVLEGKSGVMLTGSHNPPDYNGFKIVVAGETLANEQIQALR
ERIESNDLASGVGSVEQVDILPRYFKQIRDDIAMAKPMKVVVDCGNGVAGVIAPQLIEAL
GCSVIPLYCEVDGNFPNHHPDPGKPENLKDLIAKVKAENADLGLAFDGDGDRVGVVTNTG
TIIYPDRLLMLFAKDVVSRNPGADIIFDVKCTRRLISLISGYGGRPVMWKTGHSLIKKKM
KETGALLAGEMSGHVFFKERWFGFDDGIYSAARLLEILSQDQRDSEHVFSAFPSDISTPE
INITVTEESKFAIIEALQRDAQWGEGNITTLDGVRVDYPKGWGLVRASNTTPVLVLRFEA
DTEDELERIKTVFRNQLKAVDSSLPVPF
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttccagcgcactgccaaggaagggaatgagctgggcgacctgctcgaagcg
gaaaagaaaccgctcaaggcgccatccgaacgtgccggcggcaaggacctgctgcccggc
atcggcgccagcctgttgggcgtggcggccgccggcgcgctcctgtggttcggcgtcttc
ggcggcgccggcgaggcgcagcaacgccagctggacgccgcctggtccgaaggccaggcc
ggcgccttgcgccaggccttgcagcaactcgccgccgacacccgcgctgccgcggccagc
cctctcgccctcgaagccctgcagagtggcgacgccgcccgtatcgaggccgcccagcgc
agcctgctggcctgggacggcgtggtcgatgcccacctgaacgcgccgggccaggccgtc
caggacaacgccagccccgctccggtcagcttcgccgccctggacatcctgcaccgggtc
gaaagcggccagagcgtcgccgccgaagcctacaaggtcggccagcgctggctgctgtac
agcgccgcgccggtgcgcggcgccgaccagagcctgcagggcacgctgctgctggcggtc
gacctgcaacggctgctgcgcgccctgccccccctgccggacgatgccggccaggtgcaa
ctggtccagcagttctccggggcgccggcccaggtgctgctgcaacgcggtacggcagcg
ccggaccagggcgcacaggcgctggacagcggcaacccgaactggaagctgaactacacc
cccggcagcaccgcggccagccaggcctcgccgttgctgctggggctcgcggcgctgctg
gcgctgctcggcggcgtgctcggcgcctacctcacccgttcgtcgctgttgcgccgcctg
caccaggatgtcctgaccctcggtcagtatcttcaggaactcggcgggcaacgcactgcc
aaaccccctgtgcccagcctgccgggcttcgccccgctgatccaggcactggcccgccag
ccgcggcgcaagccggagccggccagcgcgcccagccctgccaaggcggcgccggtcgca
ccggtggcggtgacgaaagcgcctcctcgcgaggagccggcactggcagatccgttgttc
cagaacaccgacattctggatatcgacattctcgatgaagaccaggacctcctgggattg
gagcaaacccccatcatgagcactgcaaaagccccgacgctgcccgccagcatcttccgc
gcctacgacatccgcggcgtggtaggcgacaccctcaccgccgagaccgcctactggatc
ggccgcgccatcggctctgaaagcctcgcccgcggcgagccgtgcgtcgccgtcggccgt
gatggccgcctgtccggtcccgaactggtcgagcggctgatccagggcctggtggactgc
ggttgccaggtcagcgacgtgggcatggtgccgacaccggtgctgtactacgcggccaac
gtgctcgagggcaagtccggagtgatgctcaccggcagccataacccgccggactacaac
ggcttcaagatcgtggtggccggcgagaccctggccaacgagcagatccaggcgctgcgc
gaacgcatcgagagcaacgacctggcgtccggggtcggcagcgtcgagcaggtcgatatc
ctgccgcgctacttcaagcagatccgcgacgacatcgccatggccaagccgatgaaggtg
gtggtcgactgcggcaatggcgtcgccggggtgatcgccccgcaattgatcgaggccctg
ggctgcagcgtgatcccgctgtactgcgaggtcgacggcaacttcccgaaccatcacccg
gacccgggcaagccggagaacctgaaggacctgatcgccaaggtcaaggccgagaacgcc
gacctgggcctggccttcgacggcgacggcgaccgcgtcggcgtggtgaccaacaccggc
accatcatctaccccgaccgcctgctgatgctgttcgccaaggacgtggtctcgcgcaac
ccgggcgccgacatcatcttcgacgtcaagtgcacccgtcgcctgatctcgctgatcagc
ggctacggcggccggccggtgatgtggaagaccggtcactcgctgatcaagaagaaaatg
aaggaaaccggcgccctgctggccggcgagatgagcggccacgtgttcttcaaggagcgc
tggttcggcttcgacgacggcatctacagtgccgcccgcctgctggagatcctcagccag
gaccagcgcgacagcgagcatgtgttctcggccttcccgagcgacatttccaccccggaa
atcaacatcaccgtcaccgaggagagcaagttcgccatcatcgaggcgctgcaacgcgat
gcgcagtggggcgaaggcaacatcaccaccctcgacggcgtgcgggtcgactaccccaaa
ggctggggcctggtccgcgcctccaacaccacgccggtgctggtgctgcgcttcgaggcg
gataccgaggacgagctggagcgcatcaagaccgtcttccgcaaccaactgaaggcagtg
gattcctcgctgcccgtgcccttctga

DBGET integrated database retrieval system