KEGG   Pseudomonas aeruginosa PA7: PSPA7_6112Help
Entry
PSPA7_6112        CDS       T00569                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSPA7_6112 (gmk)
Enzymes [BR:pap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PSPA7_6112 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6319087..6319698
Genome map
AA seq 203 aa AA seqDB search
MSGTLYIVSAPSGAGKTSLVKALLDAAPEVRVSVSHTTRGMRPGEVDGVNYHFTRREEFL
EMLERNEFLEHAEVFGNLYGTSQRWVEKTLAEGLDLILEIDWQGAQQVRRLMPEAQSIFI
LPPSQEALRQRLTNRGQDSDEVIERRMREAVSEMSHYVEYDHLVINDDFAHALDDLKAIF
RARQLRQDAQQQRHAELLGRLLA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcaccctgtacatcgtttccgctccctccggcgccggcaagaccagcctggtg
aaggccctgctcgacgccgcccccgaggtccgcgtctccgtctcccacaccacccgcggc
atgcgcccgggcgaggtggacggggtcaactaccacttcacccgccgcgaggagttcctc
gagatgctcgagcgcaacgagttcctcgagcacgccgaagtcttcggcaacctctacggc
acctcgcagcgctgggtcgagaagaccctcgccgaaggcctcgacctgatcctcgagatc
gactggcagggcgcccagcaggtacgccggctgatgcccgaggcccagtcgatcttcatc
ctcccgccgagccaggaagccctgcgccagcgcctgaccaaccgcggccaggacagcgac
gaggtgatcgagcggcgcatgcgcgaagccgtcagcgaaatgagccactacgtggagtac
gatcacctggtgatcaacgacgatttcgcccacgccctggacgacctgaaggcgatcttc
cgcgcccgccagttgcgccaggacgcccagcagcaacgccacgccgaactgctcggtcgt
ctgctcgcctaa

DBGET integrated database retrieval system