KEGG   Pseudomonas aeruginosa PA7: PSPA7_6209Help
Entry
PSPA7_6209        CDS       T00569                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00625  Chloroalkane and chloroalkene degradation
pap00680  Methane metabolism
pap01100  Metabolic pathways
pap01120  Microbial metabolism in diverse environments
pap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    PSPA7_6209 (fdhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSPA7_6209 (fdhA)
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PSPA7_6209 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABR85178
UniProt: A6VEN5
Structure
PDB: 

Jmol
Position
6415740..6416939
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGPGKVEVQNIPYPKMQDPQGRQIDHGVILRVVSTNICGSDQHMVRGRTTA
PEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCRTCKEQHTGVCLTVNPARA
GGAYGYVDMGGWVGGQAEYVLVPYADFNLLKLPNREAAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIVGDVNPTRLAHARKQGFEIADLSKD
TPLHEQIAALLGEPEVDCAVDAVGFEARGHGHSGSQQEAPATVLNSLMGITRVAGKIGIP
GLYVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRIKIA
DIVGVEVITLDDAPKGYGEFDAGVPKKFVIDPHNLFRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaatcgtggtgtggtctatctcggcccgggcaaggtcgaggtgcagaacatt
ccctatccgaagatgcaggacccgcagggccggcagatcgaccacggggtgatcctgcgg
gtggtctccaccaacatctgcggctccgaccagcacatggtgcgcggccgcaccaccgcg
ccggaaggcctggtgctgggccacgagatcaccggcgaggtggtggagatcgggcgtggc
gtggaaaccatgaagatcggcgatctggtctcggtaccgttcaacgtcgcctgcggccat
tgccgcacctgcaaggaacagcacaccggcgtctgcctgacggtcaatccggcgcgggcc
ggcggcgcctacggctacgtcgacatgggtggctgggtcggcggccaggccgaatacgtg
ctggtgccctacgccgacttcaacctgctgaaactgcccaaccgcgaagcggcgatggag
aagatccgcgacctgacctgcctctcggacatcctccccaccggctaccacggcgcggtc
accgccggcgtcggtccgggcagcacggtctacatcgccggcgccggtccggtcggcctg
gccgcggcggcctcggcacgcctgctcggcgcggcggtggtgatcgtcggcgacgtcaac
ccgacccgcctggcccacgccaggaaacagggcttcgagatcgccgacctgtccaaggac
actccgctgcacgaacagatcgccgccctgctgggcgagccggaggtcgactgcgcggtc
gacgcggtcggtttcgaggcgcgcggccacggccattcgggctcgcagcaggaagccccg
gccaccgtgctcaactcgctgatgggcatcacccgggtcgccggcaagatcggcatcccc
ggcctgtacgtcaccgaagacccgggtgcggtggacgcggccgccaagcacggcgccctg
agcatccgcttcggcctgggctgggccaagtcgcacagcttccataccggccagaccccg
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccggatcaagatcgcc
gacatcgtcggggtggaagtcatcaccctcgacgatgcgccgaaaggctacggcgagttc
gacgccggggtgccgaagaaattcgtcatcgacccgcacaacctgttccgcgcggcctga

DBGET integrated database retrieval system