KEGG   Pseudomonas aeruginosa PA7: PSPA7_6210Help
Entry
PSPA7_6210        CDS       T00569                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_6210
Enzymes [BR:pap01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSPA7_6210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6417062..6417979
Genome map
AA seq 305 aa AA seqDB search
MSTDSPINRVEQVQVDDLACWRIHTAHGQALIAQQGAQLLSYQPHEQPPLVWLSDEAGYR
RGQSVRGGVPVCWPWFGPLERNPQEVRGQVEDGLKAPAHGLVRAVDWEIDDIAEEDGDLC
VSFRLDAPDGLPGWPHPAALRMLFRFGERLTLRLSTENLGSKPLVLSQALHTYFAVSDSR
EIAIEGLEGARYIETLENWEERTQHGAVRVKGELDRIYLGLERDLLIKDPRWERSIHLHA
LDSRSAVVWNPWVDKSRRLSQFADDAWQQMLCIETGRVWDDLMLVAPGRSESFGVQIWSE
PLERP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgatagcccgatcaaccgcgtcgaacaggtacaggtcgacgacctggcctgc
tggcgcatccacaccgcccatggccaggcgctgatcgcccagcagggcgcgcagctgctc
agctaccagccccacgaacagccgccgctggtctggctcagcgacgaggccggctaccgc
cgcgggcagtcggtacgcggcggggttccggtgtgctggccgtggttcggtccgctggag
cgcaacccgcaggaagtccgcggccaggtggaagatggcctgaaggcgcccgcccacggg
ctggtccgggcggtcgactgggaaatcgacgacatcgccgaggaggacggcgacctctgc
gtcagcttccgcctcgacgcccccgacggcctccccggctggccgcacccggcggcgctg
cgcatgctgttccgcttcggcgagcggctgaccctgcggctgtccaccgagaacctcggc
agcaagccgctggtgctcagccaggcactgcacacctacttcgcggtcagcgacagccgc
gagatcgccatcgagggcctggaaggcgcgcgctacatcgagaccctggaaaactgggaa
gaacgcacccagcacggcgcggtacgggtcaagggcgaactggaccgcatctacctcggc
ctcgagcgcgacctgctgatcaaggacccgcgctgggaacgcagcatccacctgcacgcc
ctcgactcgcgctcggcggtggtctggaacccctgggtggacaagtcgcggcggctctcg
caattcgccgacgacgcctggcagcagatgctctgcatcgagaccgggcgggtctgggac
gacctcatgctggtcgcacccgggcgcagcgaaagctttggcgtgcagatctggagcgag
ccgctggagcggccctga

DBGET integrated database retrieval system