KEGG   Pseudomonas aeruginosa PA7: PSPA7_6286Help
Entry
PSPA7_6286        CDS       T00569                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6502236..6504242)
Genome map
AA seq 668 aa AA seqDB search
MSRDDAQRWKDKYLENIEQQERLQRRWDARIDLLRRGLVRSSLAAEGSDKAVDLCMKELR
EIIRRDDMDAGLAGLIPRLEKAVLDSEQRRQQRTQQNIDALGELAQQLLALDLPRELRKP
LKQFARDIEERAWQSREIPILLGELSRLQRQVLAERKGGDGDDSRPSLLQRLFGGKEAET
AVARANPALPMASAVAPTTGPAPVAQPLPVGAGSPRGEVEASVPAGLSTAPESVAAAPPA
RRGALAARGESNQIRLEEPRPIWLDSLPLPGGLVFRETPGEPSVEQELDIEPEEPGEPVD
NLAEATADETYALPPPMPEPGYSAVAPHIEASLLRLLDGLSLPSSHQPQAEALRVRIDGS
LNWYELVPVLDDLAVLVLSLADSGQRDFEEYLRQLNERLESFLGHLGDAHAGYTGVLDNA
RGFDQTLREQVSGLQASVQQATDLDSLKLAVDSRLNGLLASMDEHQREQAEHEQEVSGRL
QALMERVNSMEQDAKAFHTHLEDQRQKALTDPLTGLPNRAALSERLEQEVARRRRDGGEL
LLAVLDIDHFKRINDDFGHLAGDKVLKIIAGELRKRLRQADFIARFGGEEFVVLLPATPL
DAGRQLLERLRAAIAACPFHFKGEPLSITCSAGITAFVGNEAGEAAFERADQALYRAKRA
GRDRLEVA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcgacgacgcccagcgctggaaagacaagtacctggagaacatcgagcagcag
gagcgcctgcagcgccgctgggatgcgcgcatcgacctgctgcgtcgcggcctggtgcgc
agcagcctggcggccgaaggcagcgacaaggcggtcgacctgtgcatgaaggagctgcgc
gagatcatccgccgcgacgacatggacgccggcctggccggcctgattccccgcctggag
aaggccgtgctcgactccgagcaacgtcgccagcaacgcacccagcagaacatcgacgcc
ctcggcgagcttgcccagcaactgctggccctcgacctgccgcgggagctgcgcaagccg
ctcaagcagttcgcccgcgatatcgaggagcgtgcctggcagtcgcgcgagatacccatc
ctgctcggcgaactgagccggttgcagcgccaggtcctggccgagcgcaagggcggcgac
ggcgacgacagccggccgagtctgctgcagcgcctgttcggcggcaaggaggcggaaacc
gccgtggcgcgggcgaacccagcgctacccatggcgtcggcggtcgcgccaaccaccggg
cccgcgcctgtcgctcagcctttgccggtcggcgccggtagcccgcgcggcgaggtggag
gccagcgtcccggcagggttatccacagctccggagagcgtcgccgcggcgcctccggcg
cgacgtggcgcgctggccgcgcgcggcgagtcgaaccagatccggctggaagagccgcgg
ccgatctggctggacagcctgcccctgccagggggcctggttttccgcgaaacgcccggg
gagccctcggtggagcaggagctggacatcgagccggaagagccgggcgagcctgtggac
aacctcgccgaggcgacggccgacgagacctacgcgctgcccccgccgatgcccgaaccc
ggctacagcgcggtggcgccgcatatcgaggcgagcctgctgcgcctgctcgacggcctg
tccctgccgagcagccaccagccccaggccgaggcgctgcgggtacgcatagacggcagc
ctgaactggtacgaactggtgccggtgctggacgacctggcggtgctggtgctgtccctg
gccgacagcggccagcgcgacttcgaggaatacctgcggcagctcaacgagcgcctggaa
agcttccttggccacctgggcgatgcccacgccggctacaccggcgtgctggacaacgcg
cgcggcttcgaccagacactgcgcgagcaggtcagcggcctccaggccagcgtgcagcag
gcgaccgacctggacagcctcaagctggcggtggacagccggctcaacggcttgctcgcc
tccatggacgaacaccagcgcgaacaggccgaacacgagcaggaagtctccggccgcctg
caggcgctgatggaacgggtcaacagcatggagcaggatgccaaggcattccacacccac
ctggaggaccagcgacagaaggccctgaccgacccgctgaccggcctgcccaaccgtgcc
gcgctcagcgagcgcctggagcaggaagtggcgcgccggcgccgggacggcggcgagctg
ctgctggcggtgctggacatcgaccacttcaagcggatcaacgatgattttggccacctg
gccggtgacaaggtgttgaagatcatcgccggcgagttgcgcaaacggttgcgccaggcc
gatttcatcgcccgcttcggtggcgaggagttcgtcgtcctgcttccggccacgccgctg
gacgccggccggcaattgctcgagcggctgcgcgcggcgatcgccgcctgccccttccac
ttcaagggcgagcccctgagcatcacctgttccgcggggataaccgccttcgtcggcaac
gaggctggcgaggcggcgttcgaacgtgccgaccaggcgctgtatcgtgccaagcgcgcc
ggcagggaccgcctggaagtcgcctga

DBGET integrated database retrieval system