KEGG   Pantoea ananatis PA13: PAGR_g0028Help
Entry
PAGR_g0028        CDS       T01970                                 

Definition
beta-glucosidase A BglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g0028
Enzymes [BR:paq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PAGR_g0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
29044..30426
Genome map
AA seq 460 aa AA seqDB search
MNYRFPENFWWGSASSALQAEGDSLNGGKSPTTWDRWFAQQPHRFHQGIGPQDTSGFYQH
WQHDIALLKQLGHNSFRTSLSWARLMPDGTDAVNPDAVAFYNKVIDALLAQGITPFITLF
HFDMPLAMQDKGGWENREVVEAFGRYAQRCFALFGHKVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAANVALHTVLAHALAVRAWRNGSYDGDIGVVLNLTPSYSRSANPADVQAAH
HADLLFNRSFLDPVLKGEYPVDLLSLLSQYHQLPRCQPGDAALIADGIIDLLGVNYYQPR
RVKCRDSAVNAEAPFMPEWLFDHYEMPGRQMNPYRGWEIYAPGIYDILTNLRVNYGNPRC
FISENGMGVENEQRFIQNGEILDDYRIEFVSEHLKWLHKGIREGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQKRTIKKSGKWFAEVAENNGFN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccgttttcctgaaaatttctggtggggcagcgccagctcggcgttacaagcc
gaaggggacagcctgaatggcggtaaaagccctaccacctgggatcgctggtttgcgcaa
cagcctcaccgtttccatcaaggcattggcccacaagacacctcgggcttttatcagcac
tggcagcacgatatcgcattactaaagcagttagggcacaacagctttcgcacgtcgctg
agctgggcgcgcctgatgccagacggcactgacgccgtgaatcctgacgccgtggctttt
tataacaaggtcatcgatgcattactggcgcagggcattacaccgtttatcaccctgttt
catttcgatatgcctctggctatgcaggacaaaggcggctgggagaaccgtgaggttgtg
gaggcatttggccgctatgcccagcgctgtttcgcgctgtttggccataaggtgaaacac
tggtttaccttcaatgaaccgattgtgccggtcgaaggtggctatctgtacgattttcat
tatcccaacgtcgtggacttcagacgagcggctaacgtggccttgcacacagtcctggca
cacgcgctggcagtacgcgcctggcgtaacggcagctacgacggtgacattggtgtggtg
ctgaacctcacgccgtcctattcacgatcggcgaatccggccgatgtgcaagccgcacat
catgctgacctgttgtttaaccgtagctttctggatccggttctgaagggagaatatccc
gtggatctgctgagcttactgagtcagtaccaccagcttccgcgctgccagcctggcgac
gctgcgttgattgccgacggcattatcgaccttctgggcgtgaactattatcagccgcgc
cgggtgaagtgtcgggacagcgccgtcaatgctgaagcgccctttatgccggagtggtta
ttcgaccactatgaaatgccaggccgtcagatgaatccgtatcgtggatgggaaatttac
gcgcccggtatttacgatattctgactaacctgcgggttaattatggaaacccgcgctgt
tttatttctgaaaatggtatgggcgttgagaatgaacagcgatttattcagaacggtgaa
attctggatgattatcgtatcgaatttgtttccgaacatcttaaatggctgcataaaggg
attcgcgaaggctgtcattgtctgggttatcatatgtggacatttattgataactggtca
tggctaaacggttataaaaatcgttacggttttgtgcagttagatttagccacgcaaaaa
cgtacgattaaaaagagtggcaaatggtttgctgaggttgccgaaaataacggttttaat
tga

DBGET integrated database retrieval system