KEGG   Pantoea ananatis PA13: PAGR_g0051Help
Entry
PAGR_g0051        CDS       T01970                                 

Definition
xylose isomerase XylA
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
paq  Pantoea ananatis PA13
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAGR_g0051
   00051 Fructose and mannose metabolism
    PAGR_g0051
Enzymes [BR:paq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PAGR_g0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54440..55762
Genome map
AA seq 440 aa AA seqDB search
MHAYFDQLDRVRYEGTKTTNPLAFRHYNPDEVIMGKTMAEHLRFAACYWHTFCWNGADMF
GAGAFDRPWQKAGEALDLAKLKADVAFEFFHKLNVPYYCFHDVDVSPEGDSLKSYRENLA
VMTDKLLEKQLETGLKLLWGTANCFTHPRYGAGAATSPDPEVFSWAASQVCSAMKATQTL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNVEANHATLAGHAFHHEIATAIALGVFGSVDANRG
DPQCGWDTDQFPVSVEENALVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKVAARMLSDGELDKRVAQRYSGWNGEFGQQILKGEFSLDALAAHAHQQQFNPQ
HNSGRQEQLENLVNHYLYDF
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcttattttgaccagcttgatcgcgttcgctacgaaggaacaaaaaccaccaat
cctctggcgttccgccactacaatccggatgaagtgatcatgggtaaaaccatggccgaa
catctgcgcttcgccgcctgttactggcatacgttctgctggaacggtgccgatatgttt
ggcgcgggcgcgtttgatcgtccgtggcagaaagcgggcgaggcgctggatctggccaaa
ctcaaagcggacgtggcgttcgagttttttcacaagctgaacgtgccctattactgcttc
cacgatgttgacgtgtcaccggaaggggattcgctgaaaagctatcgcgaaaacctggcc
gtcatgaccgataaactgctggaaaagcagctggaaaccgggcttaagctgctgtggggc
acagcgaactgcttcacccatccgcgttatggtgcaggcgctgcaaccagtcccgatccg
gaggtgttttcctgggcagccagccaggtatgcagtgccatgaaagccacccagacgctg
ggcggcgaaaactatgtgctgtggggcggtcgcgaaggttatgaaaccctgctaaatacc
gacctgcgccaggagcgcgagcagatcggccgctttatgcaaatggtggtggagcacaag
cacaaaatcggcttccagggcacgctgctgatcgaacctaagccgcaggaacccaccaag
catcagtatgattatgatgtcgccacggtttatggcttcctgaagcagtttggtctggaa
aaagagattaaggtgaacgtcgaagcgaaccatgcaacgctggctggccacgctttccat
catgaaattgcaacggccattgcccttggcgtgtttggttcggtggatgctaaccgtggt
gatccgcagtgcggctgggatacggaccagttcccggtcagcgtggaagaaaacgcattg
gtgatgtacgaaatcatcaaagcaggcggtttcacgaccggcggcctaaactttgatgcc
aaagtgcgccgtcagagcaccgataagtatgacctgttctatggtcacattggcgcgatg
gataccatggcactggcgttgaaagtcgcggcgcgcatgctgtctgacggtgagctggat
aaacgcgttgcgcagcgctacagcggctggaacggtgagttcggtcagcagattttgaaa
ggcgagttctctctggacgcgctggcggcccatgcgcatcagcagcagtttaacccgcag
cacaacagtggacgtcaggagcagctggaaaacctggtgaatcactatctctatgacttt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system