KEGG   Pantoea ananatis PA13: PAGR_g0112Help
Entry
PAGR_g0112        CDS       T01970                                 

Definition
(GenBank) guanylate kinase Gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00230  Purine metabolism
paq01100  Metabolic pathways
Module
paq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PAGR_g0112
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PAGR_g0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_18 AAA_33 ABC_tran CPT AAA_22 AAA_35 MMR_HSR1 AAA_29 Dynamin_N Viral_helicase1 Adeno_IVa2
Motif
Other DBs
NCBI-ProteinID: AER30653
Position
complement(130739..131413)
Genome map
AA seq 224 aa AA seqDB search
MYTVQETDSALNQFKKIMAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRG
MRPGEAHGEHYFFVQQHEFEKMIAEDAFLEHAKVFDNYYGTSRKAIEQVLATGVDVFLDI
DWQGAQQIRAKMPEARSIFVLPPSKEELDRRLRGRGQDSEEVIARRMAQAVAEMSHYAEY
DYLIVNDDFDLALSDLKTIIRAERLRMARQKARHDALISKLLAV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
gtgtatactgtgcaggaaaccgactccgcacttaatcaattcaagaaaatcatggcccaa
ggtacgctctatattgtttctgcgcccagtggtgcaggaaaatccagtctgattcaggca
ctgttaaaaacgcagccgctgtatgatacgcaagtgtctgtttcccataccacccgtggt
atgcgtccgggcgaagcgcatggtgaacattacttctttgttcaacagcatgagttcgaa
aaaatgatcgcggaagatgcttttctggagcacgcgaaagttttcgacaactattacggc
acctcgcgtaaggcaattgaacaggtcctggcgaccggcgtggacgtttttcttgatatt
gactggcagggcgcgcagcaaattcgcgctaagatgccagaagcgcgcagcatatttgtc
ttgccgccttcgaaagaagagctggatcgtcgcctgcgtggtcgcggtcaggacagcgaa
gaggtcattgcgcgtcggatggcacaggccgtggcagaaatgagccactacgccgaatac
gactatttaattgtgaatgatgattttgatctggcgttatcggatctgaaaaccattatt
cgcgcagaacgtctgcgcatggcccgtcagaaagcgcgccatgatgctttaatcagcaaa
ctgttggcagtctga

DBGET integrated database retrieval system