KEGG   Pantoea ananatis PA13: PAGR_g0167Help
Entry
PAGR_g0167        CDS       T01970                                 

Definition
(RefSeq) triosephosphate isomerase TpiA
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAGR_g0167
   01230 Biosynthesis of amino acids
    PAGR_g0167
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g0167
   00051 Fructose and mannose metabolism
    PAGR_g0167
   00562 Inositol phosphate metabolism
    PAGR_g0167
Enzymes [BR:paq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAGR_g0167
Exosome [BR:paq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAGR_g0167
  Exosomal proteins of bladder cancer cells
   PAGR_g0167
  Exosomal proteins of melanoma cells
   PAGR_g0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(182710..183477)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTAELIDGLRKELSGVEGCGIAIAPPALYLDQAKHAISGSHIA
LGAQNVDVNLSGAFTGEVSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKYAVLKTAG
LVPVLCIGETEAENEAGKTEEVCARQLDAVLTTQGAEAFKDAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAIAEQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKQR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaagttgaatggcagcaagcatatgacagcc
gaactgatcgacggtctgcgcaaagaactgtcgggcgttgagggttgtggcatcgctatt
gcaccgcccgcgctctatcttgatcaggctaaacacgccatctccggtagccacatcgct
ctgggtgctcaaaacgttgatgtaaacctctctggcgcatttaccggcgaagtgtccgct
gaaatgctgaaagatatcggcgcgaaatacatcatcattggtcactcagaacgtcgcact
tatcacaaagagagtgacgagttcattgcgaaaaaatatgccgtgttgaaaactgctggc
ctggtgccggttctgtgcatcggtgaaactgaagcggaaaacgaagcgggcaaaaccgaa
gaagtgtgtgcacgccagcttgatgcggtgctgaccacgcagggtgcagaagcgtttaaa
gacgcggtcatcgcttacgagccggtatgggcgatcggtaccgggaagtcagccacacct
gctcaggcgcaggccgttcacaaatttattcgtgaccacattgccaaaaaagatgcggct
atcgctgagcaagtgattattcagtacggcggctcagttaacgataaaaacgctgccgag
ctgtttactcagccggacatcgacggtgccctggttggcggcgcgtcgctgaaagccgat
gcgtttgccgtgatcgttaaagctgctgcggcggctaaacaacgctaa

DBGET integrated database retrieval system