KEGG   Pantoea ananatis PA13: PAGR_g0173Help
Entry
PAGR_g0173        CDS       T01970                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:paq00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(188017..189528)
Genome map
AA seq 503 aa AA seqDB search
MTTTDKKYIVALDQGTTSSRAVVLDHDANIVAVSQREFTQIYPKAGWVEHDPMDIWASQS
STLVEVLAHADIRSDEIAAIGITNQRETAIVWDKETGKPVYNAIVWQDPRTADYCNKLKK
EGLEEYIQHTTGLVINPYFSGTKVKWILDNVEGARERAKRGELLFGTVDTWLVWKMTQGR
VHITDYTNASRTMLFNIHKLEWDERMLEILDIPRAMLPEVKSSSEVYGQTNIGGKGGTRI
PIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFMLMNTGTEAVTSTHGLLTTIACGPRGE
VNYALEGAVFIGGAAIQWLRDEMKLISDSADSEYFAMKVKDSNGVYMVPAFTGLGAPYWD
PYARGALFGLTRGANANHIIRATLESIAYQTRDVLEAMQNDANTRLQALRVDGGAVANNF
LMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQDLEEVRAKAVIEREFRPTLETT
ERNVRYAGWKKAVARAQAWEEQE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgactaccaccgataaaaaatacatcgtcgctctcgatcagggcacaaccagttcacgt
gctgtggtgctggatcacgacgctaacattgtggcggtatcgcaacgcgaatttacccaa
atctatccgaaagcgggctgggtagagcatgacccaatggatatctgggcatcacagagt
tctacgctggttgaagtgctggcacatgccgatattcgctccgatgaaatcgcggcgatt
gggattactaaccagcgtgaaaccgcgatcgtctgggataaagaaaccggtaagccagtc
tataacgccatcgtctggcaggatccccgtactgctgactactgtaataagctgaagaaa
gagggactggaagagtatatccagcacaccaccggtctggtgattaacccttacttttct
ggcaccaaagttaagtggatcctggataacgtagaaggcgcgcgcgagcgtgcaaaacgt
ggcgaactgctgtttggtacagtcgacacctggctggtgtggaaaatgacccaggggcgc
gtgcacattaccgattacaccaacgcctcacgtaccatgctgttcaacatccacaagctt
gagtgggatgagcgcatgctggaaatcctggatatcccgcgtgcgatgctgccagaagtg
aaatcttcgtctgaagtgtatggtcagacaaacattggtggtaaaggcggtacgcgtatt
cctatcgcgggtatcgcaggcgaccagcaggctgcgctgtatggtcagctgtgcgttcag
ccgggtatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggtacc
gaagccgttacctcaacgcacggcctgctgaccactatcgcctgcgggccacgtggtgaa
gtcaactatgcactggaaggggcggtctttatcggcggcgcggccattcagtggttacgc
gatgagatgaagctgatcagcgattcggctgactcagaatacttcgcgatgaaagtgaaa
gattcaaacggtgtatatatggttcctgcctttactggcctgggtgcaccttactgggat
ccctatgcacgtggcgcgctgttcggcctgacacgtggtgcgaatgcgaaccacatcatc
cgtgcaacgctggagtccatcgcttatcaaacacgtgatgtcctggaagccatgcagaat
gatgccaacacgcgcctgcaggctctgcgtgtggacggaggagcagtggctaacaacttc
ctgatgcagttccagtcagacattcttggtacacgcgttgagcgacctgaagtacgtgaa
gtcactgcgctgggtgccgcgtacctggcaggtctggcggtaggtttctggcaggatctg
gaagaagtccgtgccaaagccgtgattgagcgcgaattccgtccaacacttgaaaccacc
gagcgtaacgtccgttatgccggctggaagaaagctgtcgcgcgcgcgcaagcgtgggaa
gaacaagagtaa

DBGET integrated database retrieval system