KEGG   Pantoea ananatis PA13: PAGR_g0333Help
Entry
PAGR_g0333        CDS       T01970                                 

Definition
1,4-alpha-glucan branching enzyme GlgB
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
paq  Pantoea ananatis PA13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:paq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373402..375585
Genome map
AA seq 727 aa AA seqDB search
MSELPDRQAINALFAGNYSDPFSLLGMHKTENGLEVRALLPEALEVWVIETSTGRKLVQL
KCDDSRGFFSGVVPRRKNPFRYQLAVNWHGQQNLIDDAYRFGPLLQEMDLWLLAEGTHLR
PYETLGAHGDVIDGVIGTRFCVWAPNARRVSVVGDFNFWDGRRHPMRLRQEMGVWELFVP
GAVNGQLYKFEIIDAHGQLRIKADPLAFEAQMRPQTASMICGLPEKVEMSASRKAANEFD
KPISIYEVHLGSWRRHTDDNFWLSYKELAEQLVPYVKEMGFTHIELLPINEHPFDGSWGY
QPLGMYAPTRRFGTRDDFRYFIDSAHAAGLNVLLDWVPGHFPSDDFGLAKFDGTELYEHS
DPREGYHQDWNTLIYNFGRREVSNFLAGNALYWMERFGIDGLRVDAVASMIYRDYSRAEG
EWIPNQYGGRENLEAINFLRYTNRTLGHVAPGSVTMAEESTDYPGVSRPPEGGGLGFWYK
WNLGWMHDTLDYMKLDPVHRRYHHNLMSFGIMYNYSENFVLPLSHDEVVHGKRSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGKEWNHDVSLDWHLLEGEDNWHHGVQ
RLVRDLNHTYQHYTSLHQLDFDPAGFEWLVVDDAEHSVFAFVRRDRDGNEVIVVSNFTPV
PRPGYRFGVNQAGSWREVLNTDQHEYHGSDVRNHLVHTDQQESHGRPQSLSLNLPPLATV
WFVREGE
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagctacccgatcgccaggcgatcaatgccctttttgcgggtaattattccgac
cccttttcactgctggggatgcataaaaccgaaaatggtcttgaagtgcgtgcgctgctt
ccggaagccctggaagtctgggtcattgaaacctcaacaggacgcaaactggtccaactg
aagtgtgatgattctcgtggttttttcagtggcgtcgttcctcgtcgtaaaaatccgttt
cgctatcaactggcggttaactggcacggccagcagaacctcattgatgatgcctaccgc
tttggccctttgttgcaagagatggacttgtggctgctggcagaaggcacgcacctgcgg
ccctatgaaacgctgggcgcccacggcgacgtcattgatggtgtgattggtacgcgtttt
tgtgtctgggcacctaacgcacgccgcgtatcggttgtcggtgatttcaacttttgggac
ggccgtcgtcatccgatgcgtctgcgtcaggaaatgggcgtctgggagctgtttgttcct
ggcgctgttaacgggcaactctataaatttgaaatcatcgatgcccatggacagctccgt
atcaaggccgatcctttagcgtttgaagcacaaatgcgtccgcaaaccgcatcaatgatt
tgcggcctgcccgaaaaagtggagatgtcggcctcacgcaaggcggcaaatgagtttgat
aaacccatctctatctacgaagtgcatctgggatcgtggcgtcgccatactgatgacaac
ttctggctcagttacaaagagctggctgagcagctggtgccttacgttaaagagatgggg
tttacccatatcgagctgctgcccattaacgaacatccgtttgacggcagttggggttat
cagccgctcggtatgtatgcgcccacccgccgtttcggtacccgtgatgatttccgctac
tttatcgacagcgcccatgcggcagggctgaatgtgttactggactgggtgccaggccat
ttcccgagcgatgattttggtctggcaaagtttgatggcaccgaactgtatgagcacagc
gatccgcgtgaaggttaccatcaggactggaatacgctgatttacaactttggccgtcgg
gaagtcagtaacttcctggcaggcaatgcactgtactggatggagcgcttcggtattgat
ggcctgcgtgtcgatgcggtggcttcaatgatctatcgtgattacagccgcgccgaaggc
gagtggatccccaatcaatacggtggtcgcgaaaatctcgaagccattaatttcctgcgc
tataccaaccgtactttgggacatgtcgccccaggttcagtgacgatggctgaagagtcc
acagactatcctggtgtttcacgaccgcctgaaggtggcggcctggggttctggtacaaa
tggaacctgggctggatgcatgacacgctggactatatgaaactcgacccggtacatcgc
cgctaccatcataatctgatgagctttggcatcatgtacaactacagcgaaaacttcgtc
ctgccgctgtcgcacgatgaagtggtgcacggaaaacgctctattcttgatcgcatgccg
ggagatgcctggcaaaaattcgctaacctgcgtgcctactacggctggatgtgggcgttt
ccgggtaagaagctgttattcatgggcaacgaatttgcgcagggcaaagagtggaatcac
gatgtcagccttgactggcacctgcttgaaggtgaggacaactggcatcacggcgttcag
cgtctggtgcgcgatctgaaccatacctatcagcattacacctccctgcatcagcttgat
ttcgatccagcggggtttgagtggctggttgttgatgatgcagagcattccgtctttgcg
tttgtacgtcgcgaccgtgatggcaatgaagtgattgttgtcagcaactttacccctgtc
ccgcgtccgggctatcgcttcggcgtgaaccaggcgggcagctggcgcgaagtgcttaat
accgaccagcatgaataccacggcagcgacgtgcgcaatcatctggtgcacaccgatcag
caggaaagtcatggccgcccgcaatcgctgagcctgaatttaccgccactggcgacggta
tggttcgtgcgggagggggaatga

DBGET integrated database retrieval system