KEGG   Pantoea ananatis PA13: PAGR_g0348Help
Entry
PAGR_g0348        CDS       T01970                                 

Definition
putative sucrose phosphorylase YcjM
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
paq  Pantoea ananatis PA13
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAGR_g0348
Enzymes [BR:paq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PAGR_g0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(394684..396369)
Genome map
AA seq 561 aa AA seqDB search
MEKITALIDKIYADAFPQAMRERLLATIVEARDTTKLPRKAHWDEQDVVLITYADQFREP
GKPTLNTFSRFYQQHLHATFPLVHLLPFYPYSSDDGFSVINYHQVDPLCGDWQDIALLHQ
ETRLMFDFVCNHMSAHSAWFKHYLAQDEGWDDFFISLPPTTDLSAVTRPRTSPLLTPFTL
ENGEIRFVWTTFSADQIDLNFARPRVLVRMVEVLLDYLKRGADYVRLDAVGYMWKTPGTN
CIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNISYFGNGQDEAQMVYQFSLPPL
VLHAIHTGSARALRQWASTLQVGNGNTTFFNFLASHDGIGLNPARGILSEVEITALVRDL
ALEGALISYKNNPDGSTSPYEINVTYFDALNREGDDDETRLKRFMLAHAILLAFPGVPAV
YIQSILGSRNDYDGVREAGHNRAINRQKYSLSAIEDALVNSDGLRHQVYTRLSKLIQQRR
RQTAFHPDNPLTLFQSDNALLIMKRYSHNGCDELLCVFNLSGRQIEAPLPEAHLFQDVVS
GEKIDGTQPVTLDAWQFMWLR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatcactgctttaatcgataagatttatgccgatgcctttcctcaggctatg
cgcgaacgcctgctcgccacgatcgttgaagcccgtgacaccactaagctgccgagaaag
gcccactgggatgagcaggacgtggtgctgattacgtatgccgatcagttccgcgagccg
ggcaaacccacactcaacaccttttcacgtttctaccagcagcatttgcacgccacgttt
ccgctggtgcacctcctgccgttttatccctattcgtctgacgacggcttttcggtcatt
aactaccatcaggtcgatccgctgtgtggcgactggcaggacattgccttactgcatcag
gaaacgcgcctgatgttcgactttgtctgtaaccatatgtcagcgcatagtgcgtggttt
aaacattatcttgctcaggatgaaggctgggatgatttttttatcagcctgccgcccacc
accgacctcagcgcggtcacgcggccacgaacgtcaccgttgctcaccccatttacgctg
gaaaacggtgaaatccgctttgtctggactacgttcagtgccgatcagattgaccttaac
tttgcccgtcccagggtgctggtgcgcatggtagaggtactactcgactatctgaaacgt
ggcgcggactatgtgcgactggatgcggtgggatacatgtggaaaacgccaggcacgaac
tgtattcacctcgaaaaaacgcatctgctggtcaaactgtttcgtgccattgccgacgtg
gtcgcacccggcaccgtcatcatcaccgaaacgaatgtgccgcacaaagacaacatcagc
tactttgggaacgggcaagacgaagcccagatggtgtatcagttttccttaccgccgctg
gtgctacacgccatccacaccggatcggctcgcgctctgcgtcaatgggccagcaccctg
caggtgggaaatggcaatacaaccttttttaacttcctggcctcgcacgatggtataggt
cttaatccggcacgcgggattttatcggaggtggagatcacggcgctggtgcgcgatctg
gcactggagggggcgctgatctcctataaaaacaatcctgacggcagcaccagcccatac
gaaatcaacgtgacctatttcgacgcgcttaaccgtgaaggcgatgacgacgaaacgcgc
ctcaaacgctttatgctggcgcatgctattttactggcctttccgggtgttccagccgtc
tatattcaaagcatcctgggatcgcgtaatgactatgacggcgtacgtgaggcaggccat
aaccgggccattaaccggcaaaaatattcgctctccgctatcgaagacgcactggtgaac
agcgacggcttacgccatcaggtttatacccggctgagcaaactgattcagcagcgtcga
cgccagacggcctttcatcccgacaacccgttgacgttgtttcagagcgataatgccctg
ctcatcatgaagcgttattcgcataacggctgtgatgaattactgtgtgtgtttaatctc
agtggcaggcagattgaagccccgttaccggaggcgcatctttttcaggatgtggtaagc
ggtgagaaaattgatggcacccagccagtaacgctggatgcctggcaattcatgtggcta
cgataa

DBGET integrated database retrieval system