KEGG   Pantoea ananatis PA13: PAGR_g0517Help
Entry
PAGR_g0517        CDS       T01970                                 

Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
paq  Pantoea ananatis PA13
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PAGR_g0517
Enzymes [BR:paq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PAGR_g0517
Transfer RNA biogenesis [BR:paq03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PAGR_g0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
557850..558593
Genome map
AA seq 247 aa AA seqDB search
MLEQISQLAREAGDAIMQVYNGSVPTDVSHKADDSPVTAADLAAHDVIVSGLKQLTPDIP
VLSEEDPPGWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGKPVMGVVYAPAL
GVMYSAAEGKAWKEENGERQQIHVLDARPPLVVVSRSHNDDDEMKEYLKQLGEHQTVATG
SSLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAAAAGAHVHDWQGRTLDYAPRESFLNP
GFRVSLF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaataagccaactggcgcgtgaagcaggcgacgcgattatgcaggtctac
aacggttccgttccgacagacgtttctcacaaagcggatgattctcctgtcacggcggca
gacctggccgctcatgatgtgattgtgtcgggcttaaaacagctgacaccggatattccg
gtactatcagaggaagatccgcccggctgggaggttcgccagcactggcaacgttactgg
ctggttgacccgctggatggcaccaaagaatttatcaaacgtaacggcgaatttaccgtg
aatattgcgctgattgagcagggcaaaccggtaatgggcgtggtttatgctcccgcgctg
ggcgtgatgtattccgccgcagagggcaaagcctggaaagaagagaacggcgagcgacaa
cagattcatgtgcttgatgcgcgtccaccgttagtggtggtgagccgttcgcacaacgac
gacgacgagatgaaagagtacctcaagcaactgggggaacatcagacggtggcaaccggg
tcatcactgaagttttgcctggtggcagaagggaaagcacagctctatccgcgctttggg
ccaaccaatatttgggataccggagcgggtcatgccgttgccgcggccgcgggtgctcac
gttcacgactggcagggaagaacactggactatgcaccgcgtgaatcttttcttaatccc
ggctttcgcgtctcgctgttttaa

DBGET integrated database retrieval system