KEGG   Pantoea ananatis PA13: PAGR_g0780Help
Entry
PAGR_g0780        CDS       T01970                                 

Definition
thymidine phosphorylase DeoA
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
paq  Pantoea ananatis PA13
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAGR_g0780
Enzymes [BR:paq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PAGR_g0780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821643..822971
Genome map
AA seq 442 aa AA seqDB search
MYLAQEIIRKKRDGHALSEDEIRFFINGVRDNSVSEGQIAALAMTIYFHDMSLPERVALT
MAMRDSGTVLNWKSLNLNGPVVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPSDDHFRQTIKQVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYEASENLAQAIVGVANGAGCRTTALLT
DMNQVLASTAGNALEVREAVRFLTGAQRNPRLLEVTLALCSEMLISGKLAENEAEAREKL
MTVLDNGKAAEVFARMVAAQKGPTDFVERYDSYLPAPTMSKAVFADRAGCVTHMDTRALG
MAVVAMGGGRQRASDAIDYSVGLSDMITLGEQVDASRPLAVIHASSEAHWQQAAAAVKAA
ITLGERAPAATPVVYRRVTEAG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtaccttgcacaagaaatcattcgaaaaaaacgtgacggccacgcgctgagtgaagac
gagattcgtttcttcattaacggcgtgcgtgataacagcgtttcggaaggacaaattgcc
gcgctggcaatgaccatttattttcacgatatgtcgctgccggagcgggttgccctgacg
atggcgatgcgtgactcaggcaccgtgctgaactggaaatccctgaatctgaacgggccg
gtggtcgataagcactccaccggcggcgtcggcgatgtcacctcgttgatgctggggccg
atggtggccgcctgtggcggctatatcccgatgatctcaggtcgcgggctggggcacacc
ggcggcaccctggacaagctggaagcgattcccgggtttgacattttccccagtgatgac
cactttcgccagaccataaagcaggttggcgtggcaattattggccaaaccaactccctg
gctccggcggacaaacgcttttacgccacgcgcgacatcacggccaccgtggattcgatt
ccgctgatcaccgcctcgattctggcgaaaaagctggccgaagggctggatgcgctggtg
atggatgtcaaagtcggctccggggcatttatgcccacgtatgaagcctctgaaaatctg
gcgcaggccattgttggcgtcgccaacggcgcgggctgtcgcaccacggcgctgttaacg
gatatgaaccaggtgctggcctccacggccggtaacgcgctggaagtgcgcgaagcagtg
cgcttcctgaccggtgcgcagcgtaacccgcgcctgctggaagtcactttggcgctgtgc
agcgaaatgctgatctccggcaaactggcggaaaatgaggctgaggcacgcgaaaaactc
atgactgtgctggataacggcaaggccgcagaggtgtttgcccgcatggtggcggcgcag
aagggcccgaccgattttgttgagcgctacgacagctatttacctgcgccaacgatgagc
aaagcggtttttgccgaccgggcaggctgtgttacccatatggatacccgcgcgctgggc
atggcggtggtggcgatgggcggtggacgccagcgcgccagtgatgccatcgattacagc
gtgggcctgagcgacatgatcaccctgggcgagcaggtggatgcttcacgtccgctggcg
gtcatccatgccagcagtgaagcgcactggcaacaggccgctgccgccgtaaaagccgcg
attaccttgggtgaacgcgccccggcagccacgcctgtcgtgtatcgccgcgtcactgag
gcaggctga

DBGET integrated database retrieval system