KEGG   Pantoea ananatis PA13: PAGR_g0790Help
Entry
PAGR_g0790        CDS       T01970                                 

Definition
phosphoenolpyruvate phosphomutase PepM
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
paq  Pantoea ananatis PA13
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    PAGR_g0790
Enzymes [BR:paq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     PAGR_g0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
833775..834629
Genome map
AA seq 284 aa AA seqDB search
MIKKLIAEKGTLIFIEAHNPLSALIASKAEQTNSEGRIVKFDGIWSSSLTDSASRGIPDN
ETLALSSRLENIADIRNVTDMPIIMDADTGGKPEHFSYYVKRMINNGVNGVIIEDKTGLK
KNSLFGTEVEQTLADINDFSEKIKRGKSAVYIDDFMIIARLESLIAGFDVEHALERADAY
VEAGADGIMIHSCKKTPDEVFLFSTKFRKKYPSVPLICVPTTYSATSNRELSEAGFNVII
YANHMLRAAYKAMENVSKEILRYGRTAEIEKSCMSVKEIISLIP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaacttattgcagaaaagggtactctgatttttattgaggcccataatccg
ctctccgcattaattgcgtctaaagcagaacaaactaattcagaaggccgtattgtcaaa
tttgacggtatatggtcaagctcgttaacggactcagcatctcgcggtattcccgataac
gaaacactggcattaagcagcaggttagaaaatattgctgatatccgaaatgtgacagac
atgcccatcatcatggatgctgatacggggggaaaaccagaacattttagttattacgta
aaaagaatgattaacaacggtgtaaatggcgtcatcatcgaagataaaacaggattaaag
aaaaattctttgttcggcactgaagtagaacagactctcgcagatattaatgatttttca
gagaagattaaaagaggaaaatctgcagtttatattgatgattttatgatcatagccaga
cttgaaagtcttattgcagggttcgacgtagaacatgcactcgaacgtgccgacgcatac
gtcgaagccggggcagacggaattatgattcatagttgtaagaagactccggatgaggtt
ttcttattcagtacgaaatttcggaaaaaatatccatcagtaccattaatttgtgttcct
actacttattctgcaaccagcaacagagaactcagtgaagcgggttttaacgtgatcatt
tatgcaaaccatatgctcagggctgcttataaagcaatggaaaatgtttcaaaagaaata
ttgagatatggcaggacggcagagatagaaaaatcttgcatgagtgtaaaggaaattatt
tcactgattccttaa

DBGET integrated database retrieval system