KEGG   Pantoea ananatis PA13: PAGR_g0874Help
Entry
PAGR_g0874        CDS       T01970                                 

Definition
agmatinase SpeB
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
paq  Pantoea ananatis PA13
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:paq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
919885..920805
Genome map
AA seq 306 aa AA seqDB search
MYNTLGNQYDNSLVSNAFGFMRFPVNFQPYDSDAEWVITGVPFDAATSGRPGSRLGPGAI
RQISTNLAWEGCRWPWEFDLRQRLNVVDCGDLVYAFGDSQDLSDKLQAHAEKLLANGKRM
MTFGGDHYVTLPLLRAHAKHFGKMALVHFDAHTDTYSNGPTFDHGTMFFTAPKEGLIDPQ
HSVQIGIRTEFDKSLGFNVLDAAQVNDRSVDDLLAEIKRTVGDLPVYLTFDIDCLDPAHA
PGTGTPVIGGLTTDKATKLIRGLQGMNIVGMDLVEVAPGYDHADLTALAAATLALDMLHV
QAANKG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtacaataccctcggcaatcagtacgacaattcactggtttctaatgcctttggtttt
atgcgttttccggttaatttccagccttacgacagcgacgcagagtgggtgatcaccggg
gtgccctttgacgccgcgacctcaggccgtccaggcagccgtcttggcccaggcgctatc
cgccagatttcgaccaatctcgcctgggaaggctgccgctggccgtgggagtttgacctg
cgtcagcgcctgaacgtggtggactgcggcgatctggtttacgcctttggtgattcacag
gatctgtctgacaagctgcaggcccacgcagagaaactgctggcgaacggcaaacgcatg
atgacctttggtggcgatcactacgtcacgcttcccctgctgcgcgcgcatgcgaagcac
tttggtaaaatggcgctggtacactttgacgcccataccgatacctactccaatggtcca
acgtttgaccatggcaccatgttctttaccgcaccgaaagaggggctcatcgatcctcag
cactcggtgcaaatcggtattcgtaccgaattcgacaaaagcctgggctttaacgtgctg
gatgctgctcaggttaacgaccgcagcgtggacgatcttctggcggaaattaagcgcacc
gtcggcgacctgccagtttatctgacatttgatatcgactgtctggatcctgcgcatgcg
ccgggcaccggtacgccggtcattggcggtttaaccacagataaagccactaaactgatt
cgtggtttacagggcatgaatatcgtggggatggatctggtggaagtcgcgccgggttac
gatcacgccgatctaacggcacttgccgccgctacgctggcgctggacatgttgcacgtt
caggcagcgaataaaggctga

DBGET integrated database retrieval system