KEGG   Pantoea ananatis PA13: PAGR_g0897Help
Entry
PAGR_g0897        CDS       T01970                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:paq00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945876..947303)
Genome map
AA seq 475 aa AA seqDB search
MSLPKTFLWGGAVAAHQVEGGWDQGGKGISIADVLTGGAHGVDRVITDGVQPGKFYPNHQ
AVEFYSHYKQDIALFAEMGFKCFRTSIAWTRIFPNGDEPQPNEAGLQFYDDLFDELLKYG
IEPVITLSHFEMPYHLVKEYGGWHNRKVVDFFVRFSEVVLKRYKNKVKYWMTFNEINNQR
NWQYPLFGYCCSGVIFTEHEKPEQAMYQVMHHQFVASAKVVKLGHEINPEFKIGCMIAMV
PVYPFSCHPDDVMLAQEAMHQRYVFSDVQMRGYYPAYALKEWARKGYHIDMEPEDAETLR
NGCADYVGFSYYMSTAVQTRASGVDDPITGFEGTVKNPHVKASDWGWQIDPVGLRYVLND
VYERYQKPLFIVENGFGAIDKPNAQGVIEDDYRIDYLAAHIEEMKKAVIHDGVDLMGYTP
WGCIDCVSFTTGQYNKRYGFIHVNKNDDGSGDFSRSRKKSFAWYQQVIASNGEKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaccaaaaacgtttctgtggggcggcgcggtcgcggctcatcaggtagagggc
ggctgggatcagggcggtaagggcatcagtattgctgatgtactgaccggcggcgctcat
ggcgtggaccgcgtcatcaccgacggcgtccagccaggaaaattctatccaaatcatcag
gctgttgaattttattctcattacaaacaggatatcgcgctgtttgctgagatgggattt
aaatgcttccgtacctcaattgcctggacccgtattttccctaacggcgatgaaccgcaa
cccaatgaagccggcctgcaattctatgacgatctgtttgatgaattgcttaaatacggt
attgagccggttattactctctcccattttgaaatgccctatcacctggtaaaagaatac
ggtggctggcacaatcgtaaggttgtcgatttctttgtgcgctttagtgaagttgtgctg
aagcgttataagaataaagtgaaatactggatgacctttaacgaaattaacaaccagcgt
aactggcaatatccgctgtttggttactgctgctcaggcgttattttcacggaacatgaa
aaacctgaacaggcgatgtatcaggtcatgcatcaccagtttgttgccagcgccaaagtc
gtgaagctgggccacgagatcaacccggagtttaagattggctgcatgatcgccatggtg
ccggtttaccccttctcctgccatccggatgacgtcatgctcgctcaggaagcgatgcat
caacgctatgtctttagcgacgtgcagatgcgcggttactacccggcttacgccctgaaa
gagtgggcgcgcaaaggctatcatatcgacatggagcctgaagacgctgaaaccctgcgc
aatggctgtgccgattatgtgggcttcagttattacatgagtacagccgttcagacccgc
gccagtggcgttgatgatcctattaccggcttcgaaggcacggttaaaaatccgcacgtt
aaagcctcagactggggctggcagatcgatcctgttggtctgcggtatgttcttaatgat
gtgtatgaacgctatcagaaacccctgtttattgttgaaaacggttttggcgccatcgac
aaaccgaatgcgcagggcgtgatagaggatgattaccgcattgattatctggccgcgcat
attgaagagatgaaaaaagccgtcattcatgacggggtggatctcatggggtacacgccc
tggggctgtatcgactgcgtgtctttcactaccggtcagtacaacaagcgttacggtttt
attcacgtgaataaaaacgatgacggcagcggagacttctcgcgctccaggaaaaagagt
tttgcctggtatcaacaggtcatcgccagcaatggtgaaaagctgtaa

DBGET integrated database retrieval system