KEGG   Pantoea ananatis PA13: PAGR_g0929Help
Entry
PAGR_g0929        CDS       T01970                                 

Definition
exodeoxyribonuclease V alpha chain RecD
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
paq  Pantoea ananatis PA13
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:paq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PAGR_g0929
Enzymes [BR:paq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PAGR_g0929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983085..984932
Genome map
AA seq 615 aa AA seqDB search
MSDINALLLQAVEKRLLRPLDIQFARLIADDAQPFLLLAAACVSADAGEGHVCLPLANLS
EAGLFAGRQPALAQALWQAAGAPDDVHAALAGWSAISDGSAVTPLVLSHERLYLHRLWQS
EGQVARFFSLQPDEGTFDAHRASEVLTSLFGSRPDDWQKIAAAVALTRKTAVISGGPGTG
KTTTVAKLLAALIRLNTVPLRIQLAAPTGKAAARLTESLGKALQGLAVSEEERTRFPAEA
TTLHRLLGAQPDTQRLRYHAGNLLHLDVLVVDEASMVDLSMMAKLISALPQHARVVFLGD
RDQLASVEAGAVLGDICRCSETGFSPSRAAQLTALTGCTLTGDDVEAAPAVRDSICLLRQ
SYRFDEKSGIGQLARAVNQGDARQMSAIFAAGHQDVSFQPLNDGDAYQAMLDEVARGYSD
YLHAVQHQATPEQVINAFSRYQLLCALREGPFGVHGLNQRIEQRLMQLQRIRRPALGSRW
YAGRPVMITRNDSALGLFNGDIGITLRDEEGQLRVFFPLPDGSVKAIQPSRLPSHETAWV
MTVHKSQGSEFDHTALVMPTQFLPVLTRELVYTAITRARSQLTLYSDRAIFDRAVQLQTQ
RRSGLVERLGAAGQA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatataaacgccttactgctccaggcagtcgaaaagcgtttactgcgacctctg
gatatacagtttgcccgcttgattgcggacgacgcccagccttttctgctgctggcagcg
gcctgcgtcagtgccgatgccggagaaggtcacgtctgtctgccgctggctaatctgagc
gaggccggactctttgcggggcgtcagccggccctggcccaggcactgtggcaggccgca
ggcgcgccggacgatgtgcatgctgcactggcgggctggtcagcaatcagtgatggcagt
gccgtcaccccgctggtgctgagccatgagcgtttgtatctgcatcgcttgtggcagagc
gaagggcaggttgcgcgctttttttcgttgcagcccgacgaaggaacatttgatgcgcac
cgggccagcgaggtactgaccagcctgtttggcagccgtcctgacgactggcaaaagatt
gccgcagccgtggcgctgacgcgaaaaaccgccgtgatttcaggtggtccgggaaccggt
aaaaccaccacggtggcaaagctgctggctgcgctaatccgattgaatacggtgccgctg
cgcatacagctggcggcgcccacgggcaaagccgcggcccgtttaacggagtcgctgggt
aaagctctacagggactggccgtgagcgaggaagagcgcacccggttccctgcggaagcg
acgacgctgcaccgcctgctgggtgcacaaccggacacgcagcgtctgcgctatcacgcg
ggcaacctgttgcatctggatgtactggtggtcgatgaggcctcaatggtcgacctgagc
atgatggcaaaactgatctctgccttgccacagcatgcgcgcgtggtctttctgggcgat
cgcgatcagctggcttcggtggaggcgggcgccgtgctgggggatatttgccgctgcagc
gaaacaggatttagcccgtcacgggctgcacagctgacggccctgaccggctgcacgctc
acaggcgacgatgttgaggccgcgccagccgttcgcgacagcatttgcctgctgcgacag
agctatcgttttgatgaaaagtccggaataggtcagctggcacgggcggtgaaccagggc
gatgcgcgccagatgagcgcgatttttgccgccggacaccaggatgtttcttttcagccg
ctgaacgacggcgacgcttatcaggctatgctggacgaggtagcgcggggttatagcgat
tatctgcatgccgttcagcatcaggctacgccagagcaggttattaacgcattcagccgt
tatcagctgttgtgtgccctgcgtgaagggccctttggcgtgcacgggctgaatcagcgc
attgagcaacgcctgatgcagctgcagcgcatcagacgtcctgcgttgggcagccgctgg
tatgcgggaaggccggtaatgatcacccgtaatgacagcgcactggggctgtttaacggc
gatatcggtattactctacgcgatgaggaaggccagctcagagtcttttttccgttgcca
gacggcagcgtgaaagcgattcagcccagccgtttgccgtctcatgaaaccgcctgggtt
atgacggtacacaagtcgcagggatcggagtttgaccataccgcgctggtcatgccgacc
cagtttctgccggtgctgacccgcgagctggtttataccgcaattacgcgtgcgcgcagt
caactgacgctttacagcgatcgtgcaatatttgaccgcgccgtacagctgcaaacgcag
cggcgaagcgggctggtggaaaggttaggggcggccgggcaggcgtaa

DBGET integrated database retrieval system