KEGG   Pantoea ananatis PA13: PAGR_g0991Help
Entry
PAGR_g0991        CDS       T01970                                 

Definition
protein-L-isoaspartate O-methyltransferase Pcm
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
paq  Pantoea ananatis PA13
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050023..1050649
Genome map
AA seq 208 aa AA seqDB search
MVSRRIETLLSQLRQQGIKDEHLLKAIADVPRERFIDEAFEHKAWDNMALPIGSGQTISQ
PYMVARMTALLALTEHARVLEIGTGSGYQTAILAHLVEHVYSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWQGWPSRGPFDAIIVTAAPPEIPIALIAQLAEGGIMVLPVGEEQQVLK
RLRRRGNEITEETIEPVRFVPLVQGDLA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtcggcgtattgagacattgctgtcacagctgcgtcaacagggcattaaagat
gagcacctgttaaaagccattgccgatgtcccgcgcgaacgctttattgatgaagccttc
gagcacaaagcctgggacaacatggcgctgcccatcgggtccggtcaaaccatctcgcag
ccctatatggtggcacgcatgaccgcgttgctggcgctgacagagcacgcgcgcgtgctg
gagattggcaccggttccggctaccagaccgccatcctcgcccacctggttgaacacgtt
tactcggtcgagcgcattaaaggcctgcagtggcaggccaaacggcgcctgaaacagctt
gatttacacaatgtttcaacccgacacggcgatggctggcagggttggccgtctcgtggc
ccttttgatgccattatcgttaccgcggcaccgcctgaaattccgattgcgctgatagcg
caactggcggaaggcggcattatggtgctgcccgtaggtgaggagcagcaggtgttaaag
cgtctgcgccgccgcggcaatgagattacagaagaaaccattgagccggtccgtttcgtt
cccttagttcagggcgatctggcctga

DBGET integrated database retrieval system