KEGG   Pantoea ananatis PA13: PAGR_g1223Help
Entry
PAGR_g1223        CDS       T01970                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase DapE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00300  Lysine biosynthesis
paq01100  Metabolic pathways
paq01120  Microbial metabolism in diverse environments
paq01230  Biosynthesis of amino acids
Module
paq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PAGR_g1223
Enzymes [BR:paq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAGR_g1223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AER31749
Position
complement(1315518..1316645)
Genome map
AA seq 375 aa AA seqDB search
MFCPVIELTQQLIRRPSLSPDDAGCQALLIARLEAIGFHIETMNINDTLNFWATRGEGET
LAFAGHTDIVPPGDASRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAVHPH
HKGRLAFLITSDEEASGANGTVKVVERLMARNERLDYCLVGEPSSNEVVGDVVKNGRRGS
ITANLTVHGVQGHVAYPQLADNPVHRALPALNELVATEWDQGNAFFPATSMQIANIQAGT
GSNNVIPGELFVQFNFRFSTELTDTLIQQRVAELLDRHQLRYTIEWKLSGQPFLTSRGKL
VDAVVNAVTHYNEIKPQLQTSGGTSDGRFIARMGSQVVELGPVNATIHKINECVKASDLQ
MLSRMYQRIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttttgtccggtcattgagctgacgcagcagcttattcgtcgcccttctctcagcccc
gatgacgccggatgtcaggcgctgctgatcgcacgcctggaagcgataggtttccacatc
gaaaccatgaacatcaacgacacgctgaatttctgggccacgcgcggcgaaggcgaaacc
ctggcgtttgccggccacaccgatattgttcccccgggcgatgccagccgctggattaat
cccccgtttgaacccaccatccgcgacggcatgctgtttgggcgcggtgcagcagatatg
aaaggatcgctggccgccatggttgttgccgccgagcggtttgtcgccgttcatcctcat
cacaaggggcgtctggcctttttaattacgtctgacgaagaagccagcggcgcgaacgga
acggtaaaagtggttgagcgcctcatggcgcgtaacgagcgtctggattattgcctggtc
ggagaaccttccagcaacgaagtcgtgggtgacgtcgtgaaaaatggtcgtcgtggctcc
atcaccgcgaacctgaccgtgcatggcgtacagggccatgtagcctatccgcaactggcg
gataatcccgtgcaccgtgctctgccggcgcttaacgagctggtcgccacggaatgggat
cagggtaacgcctttttcccggccaccagcatgcagatcgccaacattcaggcgggaacc
ggcagtaacaacgtcatccccggcgagctgtttgtgcagttcaacttccgtttcagtacg
gaactcaccgataccctgattcagcagcgtgtcgcagaactgctggaccgccatcagttg
cgttacaccattgagtggaagctttccggccagccattcctgacctcacgcggcaagctg
gttgatgccgtggtcaacgccgttacgcactataatgaaattaagccgcagttgcagact
tctggtggaacctctgacggacgttttatcgctcgtatgggctcgcaggtggtggaactg
ggtccggtgaatgccacgattcacaaaattaacgaatgcgtgaaagcatcagacttacaa
atgctgagtcggatgtatcaacgcatcatggaacaattgatcgcctga

DBGET integrated database retrieval system