KEGG   Pantoea ananatis PA13: PAGR_g1334Help
Entry
PAGR_g1334        CDS       T01970                                 

Definition
(GenBank) fatty acid oxidation complex alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00071  Fatty acid degradation
paq00280  Valine, leucine and isoleucine degradation
paq00281  Geraniol degradation
paq00310  Lysine degradation
paq00362  Benzoate degradation
paq00380  Tryptophan metabolism
paq00410  beta-Alanine metabolism
paq00640  Propanoate metabolism
paq00650  Butanoate metabolism
paq00903  Limonene and pinene degradation
paq00930  Caprolactam degradation
paq01040  Biosynthesis of unsaturated fatty acids
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
paq01212  Fatty acid metabolism
Module
paq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAGR_g1334
   00650 Butanoate metabolism
    PAGR_g1334
  Lipid metabolism
   00071 Fatty acid degradation
    PAGR_g1334
   01040 Biosynthesis of unsaturated fatty acids
    PAGR_g1334
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PAGR_g1334
   00310 Lysine degradation
    PAGR_g1334
   00380 Tryptophan metabolism
    PAGR_g1334
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAGR_g1334
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PAGR_g1334
   00281 Geraniol degradation
    PAGR_g1334
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PAGR_g1334
   00930 Caprolactam degradation
    PAGR_g1334
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PAGR_g1334
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PAGR_g1334
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PAGR_g1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: AER31858
Position
1430361..1432481
Genome map
AA seq 706 aa AA seqDB search
MEQSAFTLQMRDDHVGVITIDVPNEKMNTLKAAFAAQIAVIIAEARKHPQLLGLVLISGK
PDNFIAGADISMIDRCQSAHEAEALARQGQDVMAAIAALPFPVVAAIHGACLGGGLELAL
ACNARICSLDDKTRIGLPEVQLGLLPGSGGTQRLPRLIGVQKALPLILTGKNLRARQAKK
LGIVDDAVPQAILLDAAVELVKKGKYRRAPLPLRDRLLQGPMARQALFALVRRETDRKTQ
GNYPAARRIIEVVRIGLEQSSQAGYAAEARAFGELAMTPESAALRSLFFASTAIKKENGT
QAEPRPLQRVGVLGGGLMGGGIASVSAVNAGLPVRIKDISLKGINHALQTSWDLLSKKVK
RRQISPAQRQQQMARISGSTDYQGFTQRDIVIEAVFEDLDLKRQMVADIEANCQPQTIFA
SNTSSIPIAEIAATARRPENIIGLHYFSPVEKMPLVEVIPHATTSPETIASTVMLARKQG
KTPIVVADKPGFYVNRILTPYINEAMRCVVEGEPIDHIDRALVKAGFPVGPVQLLDEVGI
DVGSKISPGLQQAYGERFAAPSALDAVIKDGRKGRKNGRGFYLYGSSRLSRKKVDPAVYG
LVKTRPVAKQSGAQIAERCMMMMLNEAVRCLDEQVIRSPRDGDIGAVFGIGFPPFLGGPF
HYIDRLGAAEIVNRLTRLQQQYGDRFAPCDALLRAAEQQTKFYTSS
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaacagagcgcgttcacattacagatgcgggacgatcatgtaggcgtgatcaccatt
gatgtacccaatgaaaagatgaatacgcttaaagcggcattcgcggcacagattgcggta
attattgcggaagcacgcaagcatccgcaactgctggggctggtgctgatttcaggcaaa
cctgacaactttattgcaggggctgatatcagcatgatcgatcgctgccagagcgcccac
gaggcagaagcgctggccagacaagggcaggacgtgatggcggcgattgcggcattgcca
tttcctgtggtggcggcaatccatggtgcttgtctgggcggcgggcttgagctggcgctg
gcctgcaacgcgcgcatctgttcgctggacgataaaacccgtattggcctgcctgaagtg
cagttggggctgctgccggggtcgggcggcacgcagcgcctgcctcgcttaatcggcgta
cagaaagccttaccgcttatccttaccggtaagaacctgcgggccaggcaggcgaaaaag
ctgggcattgttgatgatgccgtgccgcaggccatcctgcttgacgccgccgttgaactg
gtgaagaaagggaaataccgcagagcgccgctgcccctgcgcgatcgtctgttgcagggc
ccgatggctcgtcaggcgctgttcgcactggtcagacgcgaaaccgatcgtaaaacccag
ggtaactacccagcggcacgacgcattatcgaggtggttcgcatcggcctggagcagagc
agccaggccggttacgccgcggaagcgcgggcgtttggcgaactggcgatgacgccagag
tcggccgcgctgcgcagcctgttttttgcttccaccgccatcaagaaagagaacggcacc
caggctgaaccacgaccactccaacgggtcggtgtgctgggcggcgggctgatgggcggc
gggatcgccagcgtcagcgccgttaatgcggggctaccggtgcgcatcaaggatatcagt
cttaaaggcatcaaccatgccctgcaaaccagttgggatctgctgagtaaaaaagtgaaa
cgccggcaaatcagtccggcacagcgtcagcagcagatggcgcgcatcagcggcagtacc
gactatcagggattcacccagcgcgatatcgtgattgaggcggtctttgaggacctggat
ctgaaaagacagatggtggcggacatcgaggcgaactgtcagcctcagacgatctttgct
tccaatacctcatcgattcccattgccgagattgcggcgacggcacggcgcccggagaac
atcatcggcctgcactattttagcccggtggaaaaaatgccgctggtcgaggtgatcccg
catgccacgacctcgcctgaaacgattgccagtacggtaatgctggcacggaaacagggt
aaaacgccgatagtggtggccgataaacctggtttttacgtcaaccgtatcctcacacct
tacatcaacgaggccatgcgctgcgtggtggagggggaaccgatcgatcacattgatcgg
gcgctggtgaaggcgggattcccggtggggccggttcagctactggatgaagttggcatt
gatgtcggcagtaagatttcaccgggcctgcagcaggcttatggcgagcggtttgccgcg
ccttccgcgctggatgccgtgattaaagacggtcgcaaaggacgcaaaaacggtagggga
ttctacctgtacggatcgtcgcgtctgtcgcgtaagaaggtcgatccggcggtgtacggc
ttagtgaagacccggccggtggcaaagcaaagcggcgcccagattgccgaacggtgcatg
atgatgatgttaaacgaagcggtgcgttgcctggatgagcaggttatccgctcaccgcgg
gacggcgatatcggtgcggtgtttggcattggtttccccccctttttgggcgggccgttc
cattacatcgacaggctgggcgcggcagaaatcgtcaacagattaacgcggcttcagcaa
cagtacggggaccgttttgcgccctgtgacgcgttgctgcgcgcagcggagcagcagaca
aagttttacacttcttcataa

DBGET integrated database retrieval system