KEGG   Pantoea ananatis PA13: PAGR_g1485Help
Entry
PAGR_g1485        CDS       T01970                                 

Definition
GTP cyclohydrolase I FolE
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
paq  Pantoea ananatis PA13
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAGR_g1485
Enzymes [BR:paq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PAGR_g1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1619627..1620292
Genome map
AA seq 221 aa AA seqDB search
MSTLSQEAALVHEALLARGLETPLRAPTREIDDETRKSLIAGHMTEIMQLLNLDLEDDSL
METPHRIAKMYVDEVFSGLDYANFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
KATVAYIPKDKVIGLSKINRIVQFFAQRPQVQERLTQQVLLALQTLLGTNNVAVSIDAVH
YCVKARGVKDATSATTTTSLGGLFKSSQNTRQEFLRAVRHN
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccttgagtcaggaagctgcactggtccacgaagcgctgctagcgcgtgggctg
gaaacgccgctgcgcgcacccacgcgtgaaatagacgatgaaacgcgtaaaagcctgatt
gcaggccatatgacggaaatcatgcagctgctgaatctggatcttgaagatgacagcctg
atggaaaccccgcatcgcatcgccaaaatgtatgtcgatgaggtcttttccggtctcgat
tatgccaacttccccaaaatcacgctcatcgaaaacaagatgaaagtggatgagatggtg
acggttcgcgacattacgctgaccagcacctgcgaacatcattttgtgattatcgacggg
aaagccaccgtcgcgtatatccctaaagataaggtgatcggcttatccaagatcaaccgc
atcgtgcagttcttcgcgcagcggcctcaggtgcaggagcgtttaacacagcaggtcctg
ctggcgctgcaaacgctgttgggaacgaataacgttgccgtttcgatcgatgccgttcac
tactgtgtgaaagcgcgcggcgtgaaggatgccaccagcgccacgaccacgacctcgctg
ggtgggctgtttaaatccagtcaaaatacccgtcaggaattcctgcgcgcggtgcgtcat
aactaa

DBGET integrated database retrieval system