KEGG   Pantoea ananatis PA13: PAGR_g1535Help
Entry
PAGR_g1535        CDS       T01970                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
paq  Pantoea ananatis PA13
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAGR_g1535
   00052 Galactose metabolism
    PAGR_g1535
   00500 Starch and sucrose metabolism
    PAGR_g1535
   00520 Amino sugar and nucleotide sugar metabolism
    PAGR_g1535
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAGR_g1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1685490..1686386
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASK
NAVENHFDTTYELEALLEARVKRQLLSEVQSICPPGVTIMNVRQAQPLGLGHSILCARPM
IGDNPFVVVLPDVLLDDSTADHLRYNLAAMVARFEETGHSQVLAKHLTDYDLSEYSVITT
EQPLENPGDVSTITDFVEKPEHPAELNSDLAAVGRYVLSADIWAELERTEPGAWGRIQLT
DAIASLSKKKTVDVSLMTGHSFDCGRKMGYMQAFVSYGLRNNAQGRDFREAIEKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagcagtaatcccggttgcgggtctcggtatgcatatgcttccggcg
actaaagccattccgaaagagatgctgcctgtcgtggacaagccaatgattcaatacatc
attgatgagtgtgttgcagcagggatcaaagagattgtgctggtcacccatgcgtccaag
aatgcggtagaaaaccacttcgataccacctatgaactcgaagccctgctggaagcacgc
gttaaacgccagttgctgagtgaagtccagtcaatctgcccgccgggcgtgaccatcatg
aacgtgcgtcaggcgcagccactgggcctggggcattctattctctgcgcgcgtcctatg
atcggcgacaatccttttgtggttgtcctgcctgacgtgctgttggacgattccaccgct
gaccatttacgatataatctggcggcgatggttgcgcgttttgaagagactggtcacagc
caggtgctggcaaaacacctcaccgactacgatctgtctgaatactcagtgatcacgact
gagcagccgctggaaaacccaggtgatgtcagcacgattactgacttcgttgagaaacct
gagcatccggccgagttaaactcagacctggcagcggtgggacgctacgtgctttcagcc
gatatctgggctgagctggagcgtaccgaaccgggcgcatggggccgtattcagttaacg
gatgctatcgccagcctgagtaagaagaaaacggtcgatgtctcactcatgacgggtcac
agtttcgactgcggacgtaaaatgggttacatgcaggcatttgtctcctacggtctgcgc
aataacgctcagggccgcgacttccgcgaagcgatcgagaaaattctggcgaagtaa

DBGET integrated database retrieval system