KEGG   Pantoea ananatis PA13: PAGR_g1776Help
Entry
PAGR_g1776        CDS       T01970                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
paq  Pantoea ananatis PA13
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:paq00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1943554..1944540
Genome map
AA seq 328 aa AA seqDB search
MSLHLIHQFPRIELLGAPTPLEYLPRLSDYLGRDIFIKRDDVTPLAMGGNKLRKLEFLAA
DALREGADVLLTAGAIQSNHVRQTAAVAAKLGLKCVALLENPIATHSENYLTNGNRLMLD
LMDVEVVMVDALTQPAAQLAEQAERLEAQGFRPYILPVGGSNALGALGYVECAQEIAHQS
EGVVDFAAVLVASGSAGTHAGLAVGLEQLLPETELVGVTVSRNVAEQRPKVDALRQALAT
QLAVEAKAPVTLWDDYFAPRYGEPNEEGMEAIKLLARLEGIFLDPVYTGKAMAGLIDGIN
QNRFRREGPLLFVHTGGAPALFAYHPSV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttacatcttatccatcagtttcctcgtatcgaacttctgggcgcgccgacgccg
ctggaatatctgccccgtttatctgactatcttggtcgtgacatctttatcaaacgtgat
gacgtgacaccgctggctatgggcggtaacaagctgcgcaagctggagtttttagccgcg
gatgcccttcgtgaaggcgctgacgtgctgctgaccgccggcgccattcagtctaaccat
gtgcgtcaaacggcggccgttgcggccaaactcggcctgaaatgtgtggccttgctggag
aacccgatagcaacgcacagtgaaaactacctgaccaatggcaaccgcctgatgctggat
ctcatggatgtcgaggtggtgatggtcgatgcgctgacccaacctgccgcgcaactggcg
gaacaggcggagcggcttgaagcgcagggcttccggccttacattctgccggtgggcggt
tcgaatgcgctgggggcgctgggctatgtggaatgtgcccaggagattgctcatcagagc
gaaggggtggtggattttgcggcagtcctggtcgcatcaggcagtgccggaacgcatgcc
ggtctggcggttgggcttgaacagctgctgccggaaactgagctggttggcgtaaccgta
tcgcgtaacgtcgctgagcaacggcctaaggttgacgcactacgccaggccctggcaacg
cagttagccgtagaggcgaaggcaccggtcacgctatgggatgactattttgctccgcgc
tacggcgagccgaatgaagaaggcatggaagcgatcaaactgctggcgcgtcttgaaggg
atttttctcgatcctgtttataccggtaaagccatggcgggcctgatcgatggtatcaac
cagaatcgttttcgccgggaagggccgctgttgtttgtgcatacaggcggcgcgcccgcg
ttatttgcttatcacccttcggtctga

DBGET integrated database retrieval system