KEGG   Pantoea ananatis PA13: PAGR_g1776Help
Entry
PAGR_g1776        CDS       T01970                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
paq  Pantoea ananatis PA13
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAGR_g1776
Enzymes [BR:paq01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     PAGR_g1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1943554..1944540
Genome map
AA seq 328 aa AA seqDB search
MSLHLIHQFPRIELLGAPTPLEYLPRLSDYLGRDIFIKRDDVTPLAMGGNKLRKLEFLAA
DALREGADVLLTAGAIQSNHVRQTAAVAAKLGLKCVALLENPIATHSENYLTNGNRLMLD
LMDVEVVMVDALTQPAAQLAEQAERLEAQGFRPYILPVGGSNALGALGYVECAQEIAHQS
EGVVDFAAVLVASGSAGTHAGLAVGLEQLLPETELVGVTVSRNVAEQRPKVDALRQALAT
QLAVEAKAPVTLWDDYFAPRYGEPNEEGMEAIKLLARLEGIFLDPVYTGKAMAGLIDGIN
QNRFRREGPLLFVHTGGAPALFAYHPSV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttacatcttatccatcagtttcctcgtatcgaacttctgggcgcgccgacgccg
ctggaatatctgccccgtttatctgactatcttggtcgtgacatctttatcaaacgtgat
gacgtgacaccgctggctatgggcggtaacaagctgcgcaagctggagtttttagccgcg
gatgcccttcgtgaaggcgctgacgtgctgctgaccgccggcgccattcagtctaaccat
gtgcgtcaaacggcggccgttgcggccaaactcggcctgaaatgtgtggccttgctggag
aacccgatagcaacgcacagtgaaaactacctgaccaatggcaaccgcctgatgctggat
ctcatggatgtcgaggtggtgatggtcgatgcgctgacccaacctgccgcgcaactggcg
gaacaggcggagcggcttgaagcgcagggcttccggccttacattctgccggtgggcggt
tcgaatgcgctgggggcgctgggctatgtggaatgtgcccaggagattgctcatcagagc
gaaggggtggtggattttgcggcagtcctggtcgcatcaggcagtgccggaacgcatgcc
ggtctggcggttgggcttgaacagctgctgccggaaactgagctggttggcgtaaccgta
tcgcgtaacgtcgctgagcaacggcctaaggttgacgcactacgccaggccctggcaacg
cagttagccgtagaggcgaaggcaccggtcacgctatgggatgactattttgctccgcgc
tacggcgagccgaatgaagaaggcatggaagcgatcaaactgctggcgcgtcttgaaggg
atttttctcgatcctgtttataccggtaaagccatggcgggcctgatcgatggtatcaac
cagaatcgttttcgccgggaagggccgctgttgtttgtgcatacaggcggcgcgcccgcg
ttatttgcttatcacccttcggtctga

DBGET integrated database retrieval system