KEGG   Pantoea ananatis PA13: PAGR_g1871Help
Entry
PAGR_g1871        CDS       T01970                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
paq  Pantoea ananatis PA13
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:paq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PAGR_g1871
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PAGR_g1871
Enzymes [BR:paq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PAGR_g1871
Two-component system [BR:paq02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PAGR_g1871
Bacterial motility proteins [BR:paq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PAGR_g1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2035161..2036210
Genome map
AA seq 349 aa AA seqDB search
MSKITVMCVDDSALMRQLMTEIINSHPDMEMVATAPDPLVARDLIKQFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGQGSEITLRALELGAIDFVTKPQLGIREGMLAYS
QMIGDKIRAAARARLHVRNVMPAPVTLKAGPLLSSEKLIAIGSSTGGTEAIRHVLQPLPA
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERILPGHAYIAPGAMHMELGRSG
ANYVVKLNEGPPVNRHKPSVDVLFKSVAINAGRNAVGVILTGMGNDGAAGMLEMHRAGAW
TIAQNEASCVVFGMPREAIASGGVSEVVDLSNISQHMLAKISAGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattaccgtgatgtgcgtagatgactctgcgctgatgcggcaactgatgacc
gaaatcatcaacagtcatcctgatatggaaatggtggctacggccccggatccgttagtg
gcacgcgatctgattaaacagtttaatccgcaggtgttaacgctggatgttgaaatgccg
cgcatggacggcctggactttcttgaaaaactgatgcgtttacggcccatgcccgtggtc
atggtgtcatccctgacgggacagggctccgaaatcacgctgcgcgcgctggagttaggt
gcgatcgatttcgtgacgaagccgcagttaggtattcgtgaaggcatgctggcctacagc
cagatgattggcgacaaaattcgcgcggcggcccgggcgcgcctgcatgttcgtaacgtt
atgcccgcgccggtcacgctgaaagccggcccgttgctgagtagtgaaaagttgattgcc
attggttcatcaaccggtggcacagaggcgattcgccacgttttacagccgttaccggcc
accagtccggcactgctgattacgcaacatatgccaccgggctttacccgatcatttgcc
gagcggctgaacaagctatgccagataacggtgaaagaagcggaagatggcgagcgtatt
cttcccggccatgcctacattgcgcctggcgcaatgcacatggaactggggcgcagcggg
gcgaactacgtggtgaagctgaatgaaggccccccggttaaccggcataaaccttcagtg
gatgtcttgtttaaatcggttgcgattaacgccgggcgtaatgccgtcggcgtcatcctg
accggtatgggtaacgatggggcagcaggcatgctggaaatgcatcgtgccggcgcctgg
accatcgcgcaaaatgaagcaagttgtgtcgtttttggcatgccacgcgaggcgatagcc
agcggcggcgtgagcgaagtagtagatttaagcaacatcagccagcacatgctggcgaaa
attagcgccggacaggcattgcgtatataa

DBGET integrated database retrieval system