KEGG   Pantoea ananatis PA13: PAGR_g1988Help
Entry
PAGR_g1988        CDS       T01970                                 

Definition
pyrazinamidase/nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
paq  Pantoea ananatis PA13
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAGR_g1988
Enzymes [BR:paq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PAGR_g1988
    3.5.1.-  
     PAGR_g1988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2157427..2158035)
Genome map
AA seq 202 aa AA seqDB search
MKRALIIIDIQNDFCPGGPMAVREGDHTVAVANRYARAFHEKGECVVALQDWHPANHGSF
ASVSGEPVYTLGELNGLPQIWWPDHGVQHSAGADFHPGLDRSLFDAVFHKGQDQDVDSYS
AFFDNGHRRKTELDSWLRERGISHLVMLGLATDYCVKYSVLDALELGYQVDVVAEGCRGV
NLNPEDSDIALAQMAAQGAVIV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcactgatcattatcgatattcagaacgacttctgccccggcggcccaatg
gccgtgagagaaggcgatcacaccgtcgcggtagcaaatcgctatgcccgtgcctttcat
gagaaaggcgaatgcgtagtggccttgcaggactggcacccggccaatcatggcagcttt
gcttctgtctcgggcgagccggtttataccctgggtgagctcaacggtttgcctcaaatc
tggtggcccgatcatggtgttcagcattcggcgggcgctgattttcatcctggtctcgat
cgcagcctgtttgatgctgtttttcacaagggccaggatcaggatgtcgacagctacagc
gctttttttgataacggccatcgccgtaaaacggagctggacagctggttacgtgaacgc
ggcatcagccatctggttatgctggggctggcaaccgattactgtgtgaaatacagcgtt
ctggatgcactggaactgggctatcaggtggacgtggtcgccgaaggctgccgcggggtg
aatttgaatcctgaagacagcgacatcgcactggcccagatggccgcccagggtgcggtc
attgtctga

DBGET integrated database retrieval system