KEGG   Pantoea ananatis PA13: PAGR_g1988Help
Entry
PAGR_g1988        CDS       T01970                                 

Definition
pyrazinamidase/nicotinamidase PncA
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
paq  Pantoea ananatis PA13
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:paq00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2157427..2158035)
Genome map
AA seq 202 aa AA seqDB search
MKRALIIIDIQNDFCPGGPMAVREGDHTVAVANRYARAFHEKGECVVALQDWHPANHGSF
ASVSGEPVYTLGELNGLPQIWWPDHGVQHSAGADFHPGLDRSLFDAVFHKGQDQDVDSYS
AFFDNGHRRKTELDSWLRERGISHLVMLGLATDYCVKYSVLDALELGYQVDVVAEGCRGV
NLNPEDSDIALAQMAAQGAVIV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcactgatcattatcgatattcagaacgacttctgccccggcggcccaatg
gccgtgagagaaggcgatcacaccgtcgcggtagcaaatcgctatgcccgtgcctttcat
gagaaaggcgaatgcgtagtggccttgcaggactggcacccggccaatcatggcagcttt
gcttctgtctcgggcgagccggtttataccctgggtgagctcaacggtttgcctcaaatc
tggtggcccgatcatggtgttcagcattcggcgggcgctgattttcatcctggtctcgat
cgcagcctgtttgatgctgtttttcacaagggccaggatcaggatgtcgacagctacagc
gctttttttgataacggccatcgccgtaaaacggagctggacagctggttacgtgaacgc
ggcatcagccatctggttatgctggggctggcaaccgattactgtgtgaaatacagcgtt
ctggatgcactggaactgggctatcaggtggacgtggtcgccgaaggctgccgcggggtg
aatttgaatcctgaagacagcgacatcgcactggcccagatggccgcccagggtgcggtc
attgtctga

DBGET integrated database retrieval system