KEGG   Pantoea ananatis PA13: PAGR_g1999Help
Entry
PAGR_g1999        CDS       T01970                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
paq  Pantoea ananatis PA13
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PAGR_g1999
   00052 Galactose metabolism
    PAGR_g1999
   00500 Starch and sucrose metabolism
    PAGR_g1999
   00520 Amino sugar and nucleotide sugar metabolism
    PAGR_g1999
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PAGR_g1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2169846..2170754
Genome map
AA seq 302 aa AA seqDB search
MSAYKTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNAIENHFDTSFELESMLEKRVKRQLLDEIQSICPPHVTIMQVRQGIAKGLGHAVM
CAHPLVGDEPVAVILPDVIIDEYESNPTKDNLAEMLSRYEESGRSQIMVEPVSDVTAYGV
VDCQGAELNPGDSAPMVGVVEKPKASEAPSNLAVVGRYVLSADIWPLLAKTPPGAGGEVQ
LTDSIAMLMDKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHPVLGKEFTEWLNNTVSD
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataagaccaaagtaaaaaaagcggtaattccagtagcgggtttgggtacg
cgcatgttgcctgctaccaaagcgattccaaaagaaatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgcgggtattaatgagattgtgctggtt
actcactcctctaaaaacgccattgagaaccattttgataccagttttgaactggagtct
atgctggaaaaacgcgttaagcgccagctgctggacgaaattcagtccatctgtcctcct
cacgtgaccatcatgcaggtccgtcagggcatcgcgaaaggtctgggccatgcggtcatg
tgtgcacatcctctggtcggcgatgaacctgttgcggtcatcctgcctgacgtgatcatc
gacgaatacgaatctaacccaaccaaagataacctggcagaaatgctgagccgttacgaa
gagtctggccgtagtcagattatggttgagcctgtcagcgatgtgacggcatacggtgtt
gtagattgtcagggtgcagaactgaatcctggtgacagcgcgccgatggtcggggttgtt
gagaaacctaaagcgtctgaagcgccatccaaccttgcggttgtcggtcgttacgttctg
tctgcggatatctggccactgctggcgaaaacgcctccaggtgccggtggcgaagttcag
ctcaccgactccatcgccatgctgatggataaagaaaccgtcgaagcctatcacctgaaa
ggggtaagccacgactgtggtaacaaactgggttatatgcaggctttcgttgaatatggt
gtccgccatccggtattgggtaaagagttcactgaatggctcaacaatactgttagcgat
aaaaagtaa

DBGET integrated database retrieval system