KEGG   Pantoea ananatis PA13: PAGR_g2025Help
Entry
PAGR_g2025        CDS       T01970                                 

Definition
(GenBank) tryptophan synthase beta chain TrpB
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAGR_g2025
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAGR_g2025
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PAGR_g2025
Enzymes [BR:paq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PAGR_g2025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2194929..2196119)
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGDFGGMYVPQILMPALKQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALTL
CSNLTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPFPTIVREFQRMIGEETKKQILEKEGRLPDAVIACVGGGSNAIGMF
ADFIDEEKVKLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTDEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSVTDNEALAAFKTLCRAEGIIPALESAHALAHALRM
IKAEPEKEQLIVVNLSGRGDKDIFTVHDILTAQGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacttaatccctattttggcgacttcggcggcatgtatgtgccgcagattttg
atgccggccttgaaacagctagaagaagcttttgtcagcgcgcaaaaagatccggaattc
caggctgaatttaccgatctgctgaaaaattatgctggccgccccacagccttaaccctg
tgcagtaatctgaccaaagggtcgaaaacccgcctgtacttaaagcgcgaagacctgttg
cacggcggcgcgcacaagaccaaccaggtgttagggcaggctctgctggctaagcgcatg
ggcaaaaacgaaatcattgccgaaaccggtgcaggccagcatggcgtcgcctctgccctt
gcctgcgcgctgctgggcatgaaatgtcgcatctatatgggcgccaaagacgtagagcgg
cagtcgccaaacgtctttcgtatgcgcctgatgggcgccgaggtcatcccggtgcacagc
ggctctgccacgctgaaagatgcctgcaacgaagcgctgcgcgactggtcaggcagttat
gaaaccgctcactatatgctgggcactgcggcgggtccgcacccgttcccgacgattgtg
cgtgagtttcagcgcatgattggtgaagagaccaaaaagcagattctggaaaaggaaggt
cgcctgccggatgccgtgatcgcctgcgtcggcgggggctccaatgccatcggtatgttt
gccgactttatcgacgaagagaaggtgaagctgattggtgttgaaccggccggacacggg
attgaaaccggcgaacacggtgcaccactgaagcacggccgcgtcggcatttacttcggt
atgaaagccccgatgatgcagactgacgaagggcagattgaagagtcatactcaatttca
gccggactcgactttccttccgtcggtcctcagcacgctcacctcaacagtattggtcgg
gctgactatgtttcggtaaccgacaatgaagcgcttgctgcctttaaaacgctgtgccgc
gccgaaggtatcattcctgccctggagtcggcgcacgcgctggcccacgcgctgagaatg
attaaggcagaacccgagaaagagcagttgattgtcgtcaacctttcgggtcgcggtgat
aaagatatcttcaccgtccacgatattctgactgcgcagggagaaatctga

DBGET integrated database retrieval system