KEGG   Pantoea ananatis PA13: PAGR_g2190Help
Entry
PAGR_g2190        CDS       T01970                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
paq  Pantoea ananatis PA13
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAGR_g2190
Enzymes [BR:paq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PAGR_g2190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2379138..2381189
Genome map
AA seq 683 aa AA seqDB search
MKPLHYPAGIGRVATEYVDAHGAVRQVSASTRDRLLAAMQPGPGPGVIPPVAVFTQGLPI
RLTPSLAGPARWHLEGESGERWSGQCEPEASLTLPALPEGYHLLTINADAQQSRCQIIVT
PSRCYEPEALLRGEKRWGTCVQLYALRSDQNWGIGDFADLRDMVKAVGMRGGAFVGLNPL
HALFPALPDDASPYSPSSRRWLNVLYISVPEVEDFNLSAAAQCWWQSAETQHRLHQARHA
PWVDYSTVASLKLDALRFAWQQFMQREKEDSQAEAFEAFVAEGGESLLHQGLFDALQAWL
REEDPLSHGWQTWPTAYQQPDTAAVHAFRIEHGDEIRFYLWLQWLAARQFAACWHLCQQH
QMAPGLYRDLAVGVAAGGSETWSQRGLYCLAASTGAPPDILGPLGQNWGLPPMDPQSLYD
RAYEPWITLLRANMRDCGALRIDHVMALLRLWWIPQGETAAAGAYVAYPIDDLLAILALE
SQRQRCMVIGEDLGTVPEAIIDKLHNAGVYSYKVLYFEQNSHKGFRPPAAWPRQAMAVAT
THDMPTLRGWWQSDDLTLGSQLGLYPDKAVLAGLYHQRRAARSALLQTLTRHGYLKPKGR
VQANSPRMSLLLNQVIHQYLADCTSALLGLQPEDWLDMASPVNVPGTVEAYPNWRRKLNL
SLEAMFADKRITALLEEISRRCS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcattatccggccgggatcggcagggtagccactgaatatgttgatgcg
catggggcggtccggcaggtttctgcatcgacccgcgatcgcttgctggcggcgatgcag
ccgggccctggccctggcgttatcccaccggtcgccgtctttacccagggtttgcccatt
cgtttaacgccctctctggctggcccggcacgctggcacctggagggcgaatcgggtgaa
cgctggtcagggcaatgcgagcctgaggcgtctttgacgctcccggcgctgcctgaaggt
taccatcttctgacgataaacgcggatgcacagcaatcgaggtgccagataatagtgaca
ccgtcacgttgctatgagccggaggccttgctacggggcgagaaacgttggggaacctgt
gtccagctttacgctttacgatcggatcagaactggggaatcggcgattttgctgacctg
cgggacatggtgaaggcggttggcatgcgcggtggcgcttttgtggggctgaaccccctg
catgcgctttttcctgcgttacctgatgatgccagcccctatagcccgtcttcccggcgc
tggctcaacgtgctctatatcagcgttcctgaggttgaggactttaacctgagtgccgct
gcgcagtgctggtggcagtcggcagaaacgcaacacaggctgcaccaggcgcgtcacgcg
ccctgggtcgattattcgacggtggcatcacttaagctggatgccctgcggtttgcctgg
cagcagtttatgcagcgtgagaaagaggatagtcaggccgaggcatttgaggcgtttgtg
gctgagggcggtgaaagtctgctgcatcagggattgttcgatgccctgcaggcctggctt
cgcgaagaagatcccctgagtcacggctggcaaacgtggcccactgcctatcaacaaccc
gatacggccgccgtacacgcgtttcggattgaacatggcgatgagattcgtttctatctc
tggctgcaatggctggcggcgcgtcagtttgccgcctgttggcacctgtgccagcagcac
cagatggcacctggactttatcgcgatttggccgttggcgtcgccgcagggggatcggaa
acctggagccaacgcggactttactgtttagcggccagcacaggcgccccgccggatatt
ctgggcccgcttggccagaactgggggctgccgccaatggatccgcaatctttgtatgat
cgggcatacgaaccctggattacgttgctgcgcgcgaatatgcgcgattgtggggcgtta
cgtatcgatcatgtcatggctttgctgcgactgtggtggattccgcaaggagaaacggcc
gccgcaggcgcgtatgtcgcctatcccattgacgatctgctcgctattctggcgctggaa
agtcagcgccagcgctgcatggtgattggtgaggatttaggcacggtgccggaggcgatt
atcgataaactccacaatgctggcgtctactcgtataaggtgctctattttgagcaaaac
tcgcacaagggctttcgcccacctgcggcatggccgcgtcaggcgatggctgtagccacc
actcacgatatgccaacgctccggggctggtggcaaagtgacgatctgacactggggagc
caactggggttgtatcctgataaagcggtgcttgccgggctgtatcatcagcgccgggca
gcccgatcggcgctgcttcagaccctgacgcgccacggttacctcaagcccaaagggcgg
gttcaggcaaacagtccgcgcatgagcctgttacttaaccaggttatccatcagtatctc
gcggactgcaccagcgccctgctgggtttacaacccgaagactggctggatatggcctcg
ccggttaatgtgccgggcacggtagaggcttatccgaactggcggcgtaagctaaacctg
tcgctggaggcgatgtttgcagataagcgtatcacggcattgctggaggagatttcccgg
cgttgttcgtga

DBGET integrated database retrieval system