KEGG   Pantoea ananatis PA13: PAGR_g2230Help
Entry
PAGR_g2230        CDS       T01970                                 

Definition
ribokinase RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
paq  Pantoea ananatis PA13
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAGR_g2230
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PAGR_g2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2420434..2421291)
Genome map
AA seq 285 aa AA seqDB search
MSKIAVTGSLHYDIMLDAHHRPEKGETVMGTACHFKFGGKGGNQAIAAAKAGADVRFIGA
VGADEQGAFLLKTLRQAGVNTDAVTRIDDMASGMSVAITDAEGDYGAVVVSNANQHIAAE
PFMQAGFWQDVSMLVLQNEVPEAINLVAAQAARQQRIPVCINAAPARPLSPEFARCIDLL
VVNGVEARDMTGIAVTDLASARQAAAELALRFDRVVVTAGEHGVAFSEAGETQAFPARQV
TLVSTHGAGDCFMGVLCQALNEGDKLAGAVAKANNAAADHVSRPA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattgcagttaccggcagtcttcactacgacattatgctggatgcgcatcat
cggcctgaaaaaggcgaaacggttatgggaaccgcctgccacttcaagtttgggggcaag
ggcggcaatcaggcgatagcggccgcaaaagcaggtgcagatgtccgttttattggtgcg
gtaggggccgatgagcagggcgcgtttttgctgaaaacgctgcgccaggcaggggtgaat
accgacgcggtcacgaggattgacgatatggcgtctggtatgagcgttgccattaccgat
gctgaaggcgattacggcgcggtggtggtgtccaacgccaatcaacatatcgctgccgag
ccgttcatgcaggccggtttctggcaggatgtgtcgatgctggtgctgcagaatgaggtg
ccggaagccattaatctggtcgcggcgcaggcggcgcggcagcagcggattccggtgtgc
attaatgcggcgccggcccggccactctcgcccgaatttgcgcgctgcattgatttgctg
gtggtaaatggggttgaagcccgggatatgactggcatcgcggtgaccgatttggcctca
gccaggcaggctgcagcagagctggcactgcgttttgaccgcgtggtggtgactgccgga
gagcacggcgtggccttcagtgaagcaggggaaacgcaggcttttcctgcccgtcaggtc
accctggtcagcacccatggcgcgggcgactgcttcatgggcgtgctgtgtcaggcgctt
aacgagggcgataaacttgcgggcgccgtcgctaaagccaacaatgcggcggcagatcac
gtttcccgcccggcctga

DBGET integrated database retrieval system