KEGG   Pantoea ananatis PA13: PAGR_g2468Help
Entry
PAGR_g2468        CDS       T01970                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00900  Terpenoid backbone biosynthesis
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01130  Biosynthesis of antibiotics
Module
paq_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PAGR_g2468
Enzymes [BR:paq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PAGR_g2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C XdhC_CoxI
Motif
Other DBs
NCBI-ProteinID: AER32977
Position
2681428..2682285
Genome map
AA seq 285 aa AA seqDB search
MMTTWPAPAKLNLFLYITGRRPDGYHNLQTLFQFLDYGDSLTITPDTSDEIRLLTPVPGV
PDAQNLIVRAAESLKSAARENGSLPARAGARIAIEKRLPMGGGLGGGSSNAATVLVALNH
LWQTGFSPEALAELGVKLGADVPVFVKGYAAFAEGVGEVLSPASPAEKWYLVAHPGVSVA
TPVVFNDPALTRDTPVRSLSALLQAPFVNDCESVVRKRFREVDELVSWLLEYAPSRLTGT
GACVFAEFDTEHAARQVLELAPPWVRGFVARGLNVSPLQRTLQGD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccacctggcctgctccggcaaaactgaatctgtttttgtacatcaccggtcgt
cggcctgatggttaccataatctgcaaaccctgtttcagtttcttgattatggcgacagc
ctgacaatcacgcccgacacgagcgatgagatcaggctgttaacgccggtgcctggcgtg
ccggatgcgcaaaacctgattgtccgggcggcagagagcctcaagtcggcggcgcgtgaa
aacggcagcctgcctgccagggccggtgcgcgcattgccattgaaaagcgtttgcccatg
ggcggcgggctgggcggcggctcgtcgaatgccgcaaccgtgctggttgcgctaaaccac
ctgtggcagaccggcttttcccctgaggcgctggcggagctgggcgtgaaactgggcgcc
gacgtcccggtttttgttaaaggctatgccgcctttgccgaaggcgtcggtgaggtgctt
tctccagcatcgcctgcagaaaaatggtatcttgttgcccatccaggcgtcagcgtggcc
acgccggtggtcttcaacgatccggcgcttacccgtgacacgcccgtgcgcagtttatca
gcacttttacaggctccgttcgtcaacgattgcgaatcagtagtaagaaaacgttttcgt
gaggttgatgagcttgtttcatggctgctagaatacgcgccgtcgcgcctgacggggaca
ggtgcttgtgtgtttgctgaatttgacaccgagcatgctgctcgccaggtgctggaactt
gccccaccatgggtgcgcggttttgtagctcgaggccttaacgtctcgccgttacagcgt
actctgcaaggcgattag

DBGET integrated database retrieval system