KEGG   Pantoea ananatis PA13: PAGR_g2514Help
Entry
PAGR_g2514        CDS       T01970                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
paq  Pantoea ananatis PA13
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PAGR_g2514
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PAGR_g2514
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PAGR_g2514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2725932..2726459
Genome map
AA seq 175 aa AA seqDB search
MLIFALTNTHFKDFSMTTFHQLNATSLNGQHISMADYAGKLVLVVNTASHCGFTPQYAGL
EALYKKYAAQGLVVLGFPCNQFGKQEPGSADDIAQTCHIHYGVSFPMFEKVEVNGPGTHP
LFRYLKAELPGVLGERIKWNFTKFLIGRDGKPLKRFAPIATPEKMEATLLAALES
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
gtgctcatctttgccctgactaacacgcactttaaggatttcagcatgaccacttttcat
caactcaacgccaccagcctgaatggtcaacacatctcgatggccgactatgctggcaag
ctggttctggtggtaaataccgccagccattgtggattcactccacaatatgcaggtctt
gaagcactctacaaaaagtacgctgcgcaggggctggtggtgctgggtttcccttgcaac
cagttcggtaagcaggaaccgggcagtgccgacgacatcgcgcagacctgtcacattcac
tacggtgtgagcttccccatgttcgaaaaagtagaggttaacggccccggaacgcatccg
ctatttcgttacctgaaagcggagttacccggtgtgctgggtgagcggattaaatggaac
ttcactaagtttttgatcggacgcgacggcaaaccactcaagcgttttgcacccatcgct
acgccggaaaaaatggaagccaccctcctggcggcacttgaaagctaa

DBGET integrated database retrieval system