KEGG   Pantoea ananatis PA13: PAGR_g2649Help
Entry
PAGR_g2649        CDS       T01970                                 

Definition
beta-hexosaminidase NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
paq  Pantoea ananatis PA13
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:paq00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:paq00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2869736..2870776)
Genome map
AA seq 346 aa AA seqDB search
MTTGFPGPLMLDVEGFELDAEEREILRHPLVGGLILFARNYHDPAQLAELVRQIRAASPT
RLVVAVDQEGGRVQRFRDGFTNLPAMQSFAALNDMTTAGELAQQAGWQMAAEMIALDIDI
SFAPVLDIGHISAAIGDRAFHEDPAIALAMARRFIAGMHEAGMKTTGKHFPGHGAVSADS
HKETPRDGRSEAELREHDMAIFRTLIGEQALDAIMPAHVIYTEADPLPASGSPYWLKTVL
RQELGFKGVIFSDDLSMEGAAVMGSYAERAQQSLSAGCDMILVCNDRQGAVSVIDNLTVI
EAEPVVQLYHRGTFSRDSLKASRRWKQNAQQLSALQERWLAHKATW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggtttccccggccccttgatgctggacgtcgaaggtttcgaactggatgcg
gaagagcgtgagatactgcgccatccgctggtgggtggattaatccttttcgcccgcaac
tatcatgaccccgctcaactggccgagctggtgcgtcagattcgtgccgcctcgcctacg
cgcctggtggtggcggtggatcaggagggcgggcgagtacagcgttttcgtgatggcttt
acgaatttgcccgcgatgcagtcttttgccgcgctcaacgatatgacaacggcaggcgag
ctggcgcagcaggctggctggcagatggcggccgaaatgatcgcgctggatattgatatc
agctttgcgccggtgctggatatcggccatatcagtgcggccattggcgatcgcgcgttc
catgaggaccctgcgattgccctggcgatggcgcggcgttttattgccggcatgcatgag
gccggaatgaaaaccaccggtaagcatttccccggtcacggcgcggtcagtgcagactcc
cacaaagagacaccgcgtgatggccgcagcgaagccgaactgcgcgagcatgatatggcg
atattccgcacgctgatcggcgagcaggcgctcgacgctattatgcccgcacacgtgatc
tatacggaagccgatccgctccccgccagcggttcaccttactggctgaaaacggtgtta
cgccaggagctgggtttcaagggcgtgattttctcggacgatctttcgatggaaggcgcg
gcggtgatgggcagctatgccgagcgtgcgcaacagtctctgtctgccggatgcgacatg
attctggtctgtaacgatcgtcagggcgcggtaagcgtaatcgataatttgaccgtgatc
gaggcagagccggtggtgcagttgtaccatcggggaacctttagccgggacagcctgaag
gccagtcgccgctggaaacagaatgcgcagcagttaagcgcgctgcaggaacgctggctg
gcgcataaagcgacgtggtaa

DBGET integrated database retrieval system