KEGG   Pantoea ananatis PA13: PAGR_g2958Help
Entry
PAGR_g2958        CDS       T01970                                 

Definition
(GenBank) galactose-1-epimerase GalM
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00010  Glycolysis / Gluconeogenesis
paq00052  Galactose metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
Module
paq_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g2958
   00052 Galactose metabolism
    PAGR_g2958
Enzymes [BR:paq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PAGR_g2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AER33454
Position
3206229..3207263
Genome map
AA seq 344 aa AA seqDB search
MLNDVNSHAPDGQPWRITVLRNANGMIATFMDWGATWLSARVPLQDGHVREALLGCATPS
DYLHQDAYLGATVGRYANRIAGAKLNKISRPLSANQGEHQLHGGPGGFDKRRWQIVSQSE
TEVHYRLDSPDGDQGYPGNLIADLRYALDDDNCLSIHYQAQCDQPCPVGLTNHAYFNLDA
HHGDARQHRLQLHADRYLPVDSEGIPNGPLKAVDGTSFDFRQAKRIEQDFLADDDQKAVK
GYDHAFLLNSAGDSSQPAAELWSEDGKLQLSVTTSAPALQFYSGNYLAGTRAREQESYTA
FQGIALESEFLPDSPNHPEWPQDDCWLQPGDRWESVTRYRFTPR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgatgtgaactcccatgcgccggacggtcagccgtggcgcatcaccgtatta
cgtaatgccaatggcatgattgccacctttatggactggggcgcaacctggctgtcggcg
cgagtcccactgcaggacggtcacgtgcgtgaagccctgctgggctgtgcaaccccttcc
gactatctgcatcaggatgcctatctgggtgccacggtaggccgttatgcaaaccgtatt
gccggcgcaaaactgaataaaatcagccgcccgttgagcgccaatcagggcgaacatcag
ttacacggcggcccaggagggtttgataaacgccgctggcaaattgtcagtcagtcagaa
acggaagtgcattatcgtcttgattcgcccgatggcgatcagggctacccgggcaacctt
attgctgatttacgctatgcgctggatgacgataactgcctgtccattcactatcaggcg
cagtgcgaccagccctgcccggtcggtctcaccaaccatgcttactttaatcttgatgcg
catcatggtgatgcgcgccagcatcggttacaactgcacgccgatcgttacctgcccgtg
gatagcgaggggattcccaacggcccactgaaggccgtggacggcaccagcttcgatttc
cgtcaggccaaacgcattgagcaggattttcttgccgatgacgatcagaaggcagttaag
ggctatgaccatgctttcctgctgaacagtgcaggcgatagcagccagcctgccgctgaa
ctctggtcagaggacggcaagctccagttgagcgtgaccacgtcagcgcccgcgttacag
ttctacagcggtaactatctggccggcacgcgcgcccgggagcaggaaagctatactgct
tttcaggggatcgcgctggagagtgaatttttaccggattcgcctaatcatcccgagtgg
ccacaggatgattgctggctgcagccgggagatcgttgggaatccgtcacgcgctatcgc
tttacaccacgctga

DBGET integrated database retrieval system