KEGG   Pantoea ananatis PA13: PAGR_g2958Help
Entry
PAGR_g2958        CDS       T01970                                 

Definition
galactose-1-epimerase GalM
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g2958
   00052 Galactose metabolism
    PAGR_g2958
Enzymes [BR:paq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PAGR_g2958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3206229..3207263
Genome map
AA seq 344 aa AA seqDB search
MLNDVNSHAPDGQPWRITVLRNANGMIATFMDWGATWLSARVPLQDGHVREALLGCATPS
DYLHQDAYLGATVGRYANRIAGAKLNKISRPLSANQGEHQLHGGPGGFDKRRWQIVSQSE
TEVHYRLDSPDGDQGYPGNLIADLRYALDDDNCLSIHYQAQCDQPCPVGLTNHAYFNLDA
HHGDARQHRLQLHADRYLPVDSEGIPNGPLKAVDGTSFDFRQAKRIEQDFLADDDQKAVK
GYDHAFLLNSAGDSSQPAAELWSEDGKLQLSVTTSAPALQFYSGNYLAGTRAREQESYTA
FQGIALESEFLPDSPNHPEWPQDDCWLQPGDRWESVTRYRFTPR
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgctaaacgatgtgaactcccatgcgccggacggtcagccgtggcgcatcaccgtatta
cgtaatgccaatggcatgattgccacctttatggactggggcgcaacctggctgtcggcg
cgagtcccactgcaggacggtcacgtgcgtgaagccctgctgggctgtgcaaccccttcc
gactatctgcatcaggatgcctatctgggtgccacggtaggccgttatgcaaaccgtatt
gccggcgcaaaactgaataaaatcagccgcccgttgagcgccaatcagggcgaacatcag
ttacacggcggcccaggagggtttgataaacgccgctggcaaattgtcagtcagtcagaa
acggaagtgcattatcgtcttgattcgcccgatggcgatcagggctacccgggcaacctt
attgctgatttacgctatgcgctggatgacgataactgcctgtccattcactatcaggcg
cagtgcgaccagccctgcccggtcggtctcaccaaccatgcttactttaatcttgatgcg
catcatggtgatgcgcgccagcatcggttacaactgcacgccgatcgttacctgcccgtg
gatagcgaggggattcccaacggcccactgaaggccgtggacggcaccagcttcgatttc
cgtcaggccaaacgcattgagcaggattttcttgccgatgacgatcagaaggcagttaag
ggctatgaccatgctttcctgctgaacagtgcaggcgatagcagccagcctgccgctgaa
ctctggtcagaggacggcaagctccagttgagcgtgaccacgtcagcgcccgcgttacag
ttctacagcggtaactatctggccggcacgcgcgcccgggagcaggaaagctatactgct
tttcaggggatcgcgctggagagtgaatttttaccggattcgcctaatcatcccgagtgg
ccacaggatgattgctggctgcagccgggagatcgttgggaatccgtcacgcgctatcgc
tttacaccacgctga

DBGET integrated database retrieval system