KEGG   Pantoea ananatis PA13: PAGR_g2959Help
Entry
PAGR_g2959        CDS       T01970                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
paq  Pantoea ananatis PA13
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAGR_g2959
   01230 Biosynthesis of amino acids
    PAGR_g2959
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g2959
  Energy metabolism
   00680 Methane metabolism
    PAGR_g2959
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAGR_g2959
Enzymes [BR:paq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PAGR_g2959
Exosome [BR:paq04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PAGR_g2959
  Exosomal proteins of melanoma cells
   PAGR_g2959
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
3207413..3208165
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWRLNERHYGALQGLDKAETAAKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLKPEQLPTTESLALTIERVIPYWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgacacggcgaaagccagtggaacaacgaaaac
cgcttcaccggatggtatgatgtagacctttctgacaagggccgtaccgaagctaaagca
gccggacagctgctgaagaaagaaggtttcgtgtttgatttcgcctacacctctgtgctg
aaacgcgccattcacaccctgtggaatgtgctggatgagctggatcaggcctggctgccc
gttgagaaatcctggcgtctgaacgaacgtcactatggcgcgctgcagggcctggacaaa
gctgaaaccgccgcaaaatacggcgacgagcaggttaaacagtggcgtcgtggcttcgcg
gtgactccgccagagctggaccgcagcgatgagcgttttcctggacacgacccgcgttat
gcttcgctgaagcctgagcagctgcccaccaccgaaagcctggcgctgaccatcgaacgc
gtgatcccttactggaacgaatccattctgccacgtatcaaaagtggtgagaaagtgatc
gtggcggcccacggtaactcactgcgtgcgctggtgaaatacctggacaacatgagcgaa
gaagagattcttgaactgaatatcccgaccggcgttccgctggtgtacgagttcgatgaa
aacttcaaaccgatcaaacattactacctgggtgatgctgacgagatcgcagcgaaagcc
gcggccgttgccaatcagggtaaagcgaaataa

DBGET integrated database retrieval system