KEGG   Pantoea ananatis PA13: PAGR_g2987Help
Entry
PAGR_g2987        CDS       T01970                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein SdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
paq  Pantoea ananatis PA13
Pathway
paq00020  Citrate cycle (TCA cycle)
paq00190  Oxidative phosphorylation
paq00650  Butanoate metabolism
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01200  Carbon metabolism
Module
paq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAGR_g2987
   00650 Butanoate metabolism
    PAGR_g2987
  Energy metabolism
   00190 Oxidative phosphorylation
    PAGR_g2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AER33483
Position
complement(3239922..3240269)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGIQDWLLLRATAILITLYIIYLLGFVVMTDTLTYDIWRGFFASAFTKVF
TLLTLFSILIHGWIGMWQVLTDYVKPLATRLLLQLVIVVALLSYAIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcatccgcgttgggtcgcaatggcattcaggactggctgctgctgcgc
gcgacggcaatcctcatcacgctttacatcatctatctcctcggtttcgtggtgatgaca
gacacgctgacgtatgacatctggcgtggcttcttcgcttctgcatttacaaaagtgttc
acgctcctgacgctgttttccattctgatccacggctggatcggtatgtggcaggtctta
acggactacgttaaaccgctggcaacgcgtctgctgttgcagttggtcatcgtagtggcg
ctgttgtcatatgcaatttatggatttgttgtggtgtggggtgtgtaa

DBGET integrated database retrieval system