KEGG   Pantoea ananatis PA13: PAGR_g3121Help
Entry
PAGR_g3121        CDS       T01970                                 

Definition
endolysin
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
paq  Pantoea ananatis PA13
Brite
Enzymes [BR:paq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PAGR_g3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3378634..3379173)
Genome map
AA seq 179 aa AA seqDB search
MAMSPQLRNRLSAAMLALIAAGASAPTLMKQFQSEKEGSRLLAYQDAGGLWTICGGVTYV
DGKPVVKGMKLSQQQCDRIDAIEQRKALDWVDRNVKVPLTEVQKVGIASFCPWNIGPGKC
LSSTFYKKLNSGDRKGACAEMRRWIYDGGKDCRIRSNNCFGQVARRDQESALACWGLDQ
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtccccgcaattacgtaaccggctcagtgccgccatgctggccctgattgct
gcgggggcttcagcaccaaccctgatgaagcagttccagagcgagaaagaaggcagtcgc
ttattggcctatcaggatgctggcgggctctggactatctgcggcggcgtgacttatgtc
gacggcaagccagttgttaagggtatgaagctgtcacagcaacagtgtgatcggattgat
gctatagagcagcgaaaagcactcgactgggttgatcgcaatgtcaaagtgccgctgacc
gaagtgcagaaggttggcatcgcgtctttctgtccgtggaatatagggccggggaagtgc
ctgtcatcgacgttctataagaagctcaacagcggagaccgtaaaggcgcctgcgccgag
atgcgccgctggatttatgacggcggtaaagactgtcgcatccggtccaataactgcttc
gggcaggtggcacgccgtgaccaggaatcagcgctggcctgctggggattagaccaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system