KEGG   Pantoea ananatis PA13: PAGR_g3159Help
Entry
PAGR_g3159        CDS       T01970                                 

Definition
acyl-CoA thioesterase I TesA
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
paq  Pantoea ananatis PA13
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PAGR_g3159
Enzymes [BR:paq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PAGR_g3159
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PAGR_g3159
Lipid biosynthesis proteins [BR:paq01004]
 Fatty acid synthase
  Component type
   PAGR_g3159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3410941..3411561
Genome map
AA seq 206 aa AA seqDB search
MNFKNVFRWHYPFLLLCCLLVSRLAAADTLLVLGDSLSAGYQMSASKAWPSLLDKNWQQQ
PRVINASISGDTAAQGLARLPALLKQHQPQWVLIELGGNDGLRGFPPKDIEQTLSTIIEQ
VKTARAKPILMQVRLPANYGRRYTDAFRAIYPQLAKQHDIPLLPFFMEQVYLKPEWMQQD
GIHPNPDAQPFIAELMAKELAPLVKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaagaatgttttccgctggcattatcctttcctgttattgtgctgtctgttg
gtgtcccgtcttgctgcggccgatacgttgctggtgctgggcgacagcctgagtgcaggc
tatcaaatgtcggccagtaaagcctggcccagcctgctcgataaaaactggcagcagcag
cccagagtgattaatgccagtattagcggcgataccgccgcacaaggactggcgcgctta
cctgccctattaaaacagcaccaaccgcagtgggtgttaatcgaattgggcggtaacgac
ggcttacgtggctttccgccaaaggatatagagcaaacgttaagcaccatcatcgagcag
gtaaaaaccgccagggctaaaccgatcctgatgcaggtacgtttacccgccaactacggc
cgccgttatacggatgcgttccgcgcgatttatccgcagttggcgaaacagcacgatatt
cctttactgccctttttcatggagcaggtttatttaaaacccgaatggatgcagcaggat
ggtattcatcccaatcctgacgcccaaccctttatcgctgaactgatggcgaaagaactg
gccccattagttaagcagtag

DBGET integrated database retrieval system