KEGG   Pantoea ananatis PA13: PAGR_g3221Help
Entry
PAGR_g3221        CDS       T01970                                 

Definition
(GenBank) alcohol dehydrogenase AdhP
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00010  Glycolysis / Gluconeogenesis
paq00071  Fatty acid degradation
paq00350  Tyrosine metabolism
paq00625  Chloroalkane and chloroalkene degradation
paq00626  Naphthalene degradation
paq01100  Metabolic pathways
paq01110  Biosynthesis of secondary metabolites
paq01120  Microbial metabolism in diverse environments
paq01130  Biosynthesis of antibiotics
paq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAGR_g3221
  Lipid metabolism
   00071 Fatty acid degradation
    PAGR_g3221
  Amino acid metabolism
   00350 Tyrosine metabolism
    PAGR_g3221
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PAGR_g3221
   00626 Naphthalene degradation
    PAGR_g3221
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PAGR_g3221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AER33713
Position
complement(3475335..3476375)
Genome map
AA seq 346 aa AA seqDB search
MTMTINTMMKAAVVKAFGEPLVIEQVPVPQPGSGQILVKIAATGVCHTDLHAAEGDWPVK
PVPPFIPGHEGVGQVVAVGDNVHHLKVGDRVGVPWLYSACGHCEHCLDNWETLCHSQQNT
GYSVNGSFAEYCVADANYVGIIPENLAFNEVAPVLCAGVTVYKGLKMTDTKPGDWVVISG
IGGLGHMAIQYAVAMGLNVAAVDIDDDKLAFAQRLGASVVANARNVDPARVFHEHFGGAH
GVLVTAVSPKAFEQAIGTLRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRKDL
QEALDFASRHKVKASVAVEPLSNINDIFARMHAGKIEGRIVVDMSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgacaatcaacacgatgatgaaggcagcagttgttaaagcgttcggcgaaccc
ttggtgattgagcaggtgcccgtaccccagcctgggtcggggcagattctggtaaaaatc
gcggcaaccggcgtgtgtcacaccgatctgcatgcggcagagggcgactggccggtgaag
ccggttccgccttttatcccgggacatgagggcgtcgggcaggtggtcgcggtgggggat
aacgtacatcacctgaaggtgggcgatcgggtcggcgtgccctggctctactccgcctgc
ggtcactgcgagcactgtctcgataactgggaaacgctgtgccacagccagcaaaatacc
ggctattcggttaacggcagttttgccgaatactgcgtggcggacgccaactatgtcggc
atcatccccgaaaacctggcgttcaacgaggtggcaccggtgctctgtgcgggcgtgacg
gtctacaaagggttaaaaatgaccgacaccaaacccggtgactgggtggtgatttccggc
ataggtgggttagggcacatggctatacagtatgccgtcgcgatggggctgaacgtggcg
gctgtcgatatcgatgacgataagctggcctttgcccagcgcctgggcgccagcgtggtg
gcgaatgccagaaacgtcgatccggccagggtgtttcatgagcactttggcggcgcgcac
ggcgtgctggtcacggcggtgtcgcctaaagcctttgagcaggcgatcggcacgttacgt
cgtgggggcaccatggtgctaaacggcttgccgcctggcaaattcgatctgtctattttc
gatatggtgctggacggcattacggtgcggggttctatcgtcggaacgcgtaaggattta
caggaggcgctggattttgccagccgtcataaagtgaaagccagcgtggcggtggaaccg
ctcagcaatattaacgatatctttgcccggatgcatgcaggcaagattgaaggccgtatt
gtggtggatatgtcgttgtaa

DBGET integrated database retrieval system