KEGG   Pantoea ananatis PA13: PAGR_g3327Help
Entry
PAGR_g3327        CDS       T01970                                 

Definition
(GenBank) acireductone dioxygenase ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00270  Cysteine and methionine metabolism
paq01100  Metabolic pathways
Module
paq_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAGR_g3327
Enzymes [BR:paq01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PAGR_g3327
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PAGR_g3327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding KicB
Motif
Other DBs
NCBI-ProteinID: AER33819
Position
complement(3587021..3587563)
Genome map
AA seq 180 aa AA seqDB search
MSALTIFSDSDPSQPIWHSTDAEAIRARLNAKDVRFERWQADRDLGENPDAETVINAYQH
AIDRLVAEKGYQSWDVISMRADNPQKDVLRQKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
EILQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWIANFTGDKIADAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgaccatttttagcgatagcgatcccagccagccgatatggcacagcacc
gatgctgaggcgattcgcgcgcggctgaatgccaaagacgtccgttttgaacgctggcag
gccgaccgcgatctgggcgaaaacccggatgcggaaacggtcatcaacgcctatcagcat
gccatcgaccggctggtggccgaaaaaggctatcagagctgggatgtgattagcatgcgt
gccgataacccgcagaaggacgttctgcgccagaagtttctgtcggaacacacgcacggc
gaagatgaagtgcgcttctttgtcgagggtgcggggctgttttgtctgcatctggacggt
gaaattttgcagatcctgtgcgaaaagaacgatctgatctcggtgcccgccggcacgccg
cactggtttgatatgggatcgtccccgcacttcaccgcgattcgcatttttgataatcag
gaaggctggatcgccaatttcaccggcgacaagattgccgatgcctatccgcgcctcgcg
taa

DBGET integrated database retrieval system