KEGG   Pantoea ananatis PA13: PAGR_g3431Help
Entry
PAGR_g3431        CDS       T01970                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
paq  Pantoea ananatis PA13
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:paq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3700644..3701129
Genome map
AA seq 161 aa AA seqDB search
MTRVYLALGSNLADPLHQIDAALSALDALPETQRVATSPFYRTPPYGPPDQPDYLNAAVA
LETTLTAEALLDQTQRIEREHGRVRKAERWGPRTLDIDIMLFGTASLNSDRLIVPHYDLL
NRAFMLVPLLAIAPNLHLPDGRPLQPLLARLDCSSIRPWHS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggtttatctggcattaggcagtaaccttgccgatccgctgcatcagattgat
gcagcgctctcagccctggacgctctccctgagactcaacgcgtagctacctcccccttt
taccgcacgccgccctatggcccacccgaccagccggactaccttaatgcagcggtagcg
cttgaaaccacgctcactgccgaggcgctcctggatcaaacccagcgaattgaacgggaa
catggtcgcgttcgcaaagccgagcgctggggcccgcgcacgctggatattgatatcatg
ctgtttggtacagccagcctcaacagcgatcggctgatcgtgccgcattacgacctgctt
aatcgcgcatttatgctggtaccgctgctggcgattgcgcccaatctgcacctgcctgat
ggccgcccgcttcagccgcttctggccagacttgactgctccagcatccgtccctggcac
agttga

DBGET integrated database retrieval system