KEGG   Pantoea ananatis PA13: PAGR_g3584Help
Entry
PAGR_g3584        CDS       T01970                                 

Definition
DNA polymerase III psi subunit HolD
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
paq  Pantoea ananatis PA13
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:paq00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:paq00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:paq03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:paq03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:paq03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3889778..3890188)
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWLLQQMGITQYQLRRPRVLQGEIAVRLLPDTQLIIVAENPPGLQEPILRDVLHT
LSLKPTQVMTVTPDQLQMLPETLNCAGWLLGVESEQTFNGVALTSASFNELLSSGAARRA
LWQQMCEHDSHFFPHA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccaggcgcgactggcttttacagcaaatggggattacgcagtatcaactgcgc
cgcccgcgcgtgctccagggcgagatcgccgtacggcttttgccggatacgcagctgatt
attgtggcggagaatccgccaggtttgcaggaacccatcctgcgtgatgtcctgcacacg
ctcagtctcaaaccgacgcaggtgatgactgtgacgcctgaccagctgcaaatgctgccg
gaaacgctcaactgcgcgggctggctattgggcgttgagagcgaacaaacctttaatggc
gttgctttaaccagcgcttcttttaatgaactgcttagcagcggtgccgcccggcgcgcg
ctctggcaacagatgtgtgaacatgacagccatttctttcctcacgcctga

DBGET integrated database retrieval system