KEGG   Pantoea ananatis PA13: PAGR_g3677Help
Entry
PAGR_g3677        CDS       T01970                                 

Definition
acetylornithine deacetylase ArgE
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
paq  Pantoea ananatis PA13
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PAGR_g3677
  Amino acid metabolism
   00300 Lysine biosynthesis
    PAGR_g3677
Enzymes [BR:paq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     PAGR_g3677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3995773..3996888
Genome map
AA seq 371 aa AA seqDB search
MALTRTADLALQLTRFDTLNPPGNEAACMMFFAGWLEENGFEVTLSSFGEGRHNLIARLR
GEQAGPALAFTGHLDTVPLGNADWQHDPFGEIVDDRLYGRGSSDMKAAVAAFAVACVTHQ
QAIRQGPGVVLLITGGEETGCDGARALIDTADLPEVGALIVGEPTANYPVIGHKGALWLR
CETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTINVGRITGGLNINS
VPDRTQFDVDIRSAPNLQHATIRQQLSTLLGESVTISTLVDLPAVLSEGDHAWIQTVYQR
CQPLHDAPLVPRIVPYFTDASLLLPALGNPPCIILGPGEPSMAHQTDEYCLLSRLAEAET
LYGALICDGVR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcccttacccgcacggcggatctggcgttacagctgacccgctttgataccctcaat
ccaccgggtaacgaagccgcctgcatgatgttttttgccggctggctggaggaaaacggc
ttcgaggtcacgctgtcatccttcggcgaaggacgccataacctgatagcccgcctgcgc
ggcgagcaggccggacctgcgctggcctttaccggccatctggatacggtgccgctcggt
aacgccgactggcagcacgatccctttggcgagatcgtggacgatcggctctatggccgg
ggatcgagcgatatgaaagcggccgttgccgcctttgccgtggcctgcgttacgcaccag
caggccattcgccaggggccgggcgtggtgctgctgattaccggcggtgaggaaaccggc
tgcgacggcgcgcgggcgctgatcgataccgctgacctgcccgaggtgggcgcgctgatc
gttggcgaacccaccgcgaactatccggttatcggccacaaaggcgcactgtggctgcgc
tgtgaaacacgcggtaaaaccgcgcacggcgcgatgcccgagctgggcatcaatgcgatc
tacctggcggccgatgcgctgggtaaaattcagcatttctcccccggcgcgccgcatccg
ctgatgaaacagcccacgatcaacgtcgggcgcatcacaggcggcctgaacattaactcc
gtccctgaccgcacgcagtttgacgtggatattcgtagcgcgcccaatcttcagcacgcc
accatccgtcagcagctcagcaccttactgggcgaaagtgtgacgatatctacgctggtg
gacctgcccgcggtgctcagtgaaggcgatcacgcatggattcagacggtttatcaacga
tgccagccattgcatgatgcgccgctggtgccgcgcattgtgccctacttcaccgatgcg
tcgctgctgttgcctgcgctgggcaatccgccctgcattattctgggccctggcgagccg
tcgatggcgcatcagaccgatgaatattgcctgctgagcaggttagccgaggcggagacg
ctttatggtgcgttgatttgtgacggagtgcgatga

DBGET integrated database retrieval system