KEGG   Pantoea ananatis PA13: PAGR_g3689Help
Entry
PAGR_g3689        CDS       T01970                                 

Definition
aspartate carbamoyltransferase catalytic chain PyrB
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
paq  Pantoea ananatis PA13
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PAGR_g3689
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAGR_g3689
Enzymes [BR:paq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     PAGR_g3689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4009430..4010365
Genome map
AA seq 311 aa AA seqDB search
MANPLYRKHIISINDLSRDELELVLHTAAQLKAHPQPELLKHNVIASCFFEASTRTRLSF
ETAIHRLGASAVGFADGSNTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
NGIPILNAGDGANQHPTQTLLDLFTIRETQGRLSNLNVAMVGDLKYGRTVHSLTQALAKF
DGNRFFFIAPDALAMPAYITDMLDEQNITWSRHDSFEEVMPDLDILYMTRVQKERLDPSE
YANVKAQFILRAADLNGARDNMKVLHPLPRIDEITTDVDSTPYAWYFQQAGNGIYARQAL
LALVLNSDTAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcgcaagcatatcatttcaattaacgatctcagccgcgacgag
ctggagctggtcctgcacaccgctgcgcagcttaaagcacatccccagccggaactgctg
aaacataacgtgatcgccagctgcttctttgaggcctcgacccgcacccggctgtcgttt
gaaaccgccatccatcgcctgggcgcctctgcggtgggcttcgccgatggcagcaatacg
tcactgggtaaaaaaggggaaaccttggccgataccatttcggttatcagcacctacgtg
gatgccatcgtgatgcgtcatccgcaggagggcgccgcgcggctggccactgagttttcc
aacggcatcccgattctgaatgccggagacggcgcaaatcagcacccaacgcaaacgctg
ctggacctgttcaccattcgtgaaacccaggggcgcctcagcaacctgaacgtggcgatg
gtgggtgacctgaaatatgggcgcaccgtgcactctctgacccaggcgctggcgaagttt
gacggcaaccgcttcttctttatcgccccggacgcgctggcgatgccggcgtatattacc
gatatgctggacgagcagaatatcacctggtcacgtcacgacagctttgaagaggtgatg
ccggatctggatattctctacatgacccgggtgcaaaaagagcggcttgacccttcagaa
tatgccaacgtcaaagcgcagtttattttacgcgccgcagacctgaacggtgcgcgcgac
aacatgaaggtgctgcatccgctgccgcgcatcgatgaaatcaccaccgacgtggacagc
acgccgtacgcctggtacttccagcaggccggtaacggcatctacgcacgccaggcttta
ctggcactggttttaaacagcgacaccgccctgtaa

DBGET integrated database retrieval system